Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G09980-AT5G03660
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Family of unknown function (DUF662)
Function (paralog2):Family of unknown function (DUF662)

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.72785031924963
Log2 mRNA fold difference:0.63320253635008
Log2 TE fold difference:0.056279744692767
Sequences
Protein sequence

MKEMQAIETSQPTTVAPAVHSRQLGAQLSGSMSFSSQMSKEDEEMSRTALSAFRAKEEEI
EKKKMEIRERVQAQLGRVEEETKRLALIREELEGLADPMRKEVAMVRKKIDSVNKELKPL
GHTVQKKEREYKEALEAFNEKNREKVQLITRLMELVGESEKMRMKKLEELSKNIDSIH

MQPTETSQPAPSDQGRRLKDQLSESMSFSSQMKKEDDELSMKALSAFKAKEEEIEKKKME
IRERVQAQLGRVEDESKRLAMIREELEGFADPMRKEVTMVRKKIDSLDKELKPLGNTVQK
KETEYKDALEAFNEKNKEKVELITKLQELEGESEKFRFKKLEELSKNIDLTKP

Other information
Ka divergence:0.715731KaKs divergence:0.959107
GC content 1 (%):45GC content 2 (%):46GC content divergence:0.011
Length 1 (bp):537Length 2 (bp):522Length divergence:-0.014
MFE 1 (kcal):-146MFE 2 (kcal):-148.71MFE divergence0.009