Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10120-AT5G03890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:0.46350215742638
Log2 mRNA fold difference:0.98819281461237
Log2 TE fold difference:-0.78599074082553
Sequences
Protein sequence

MGNCLVMEKKVIKIMRNDGKVVEYRGPMKVHHILTQFSPHYSLFDSLTNNCHLHPQAKLL
CGRLYYLLPQETNSIKHMKKTMKKVRFANPEVEKEEQEEDRLTDCCDNTKEKTNGVVRVK
MVVSKQELEKLLQGGSVHEMVYRTLAKQHLCDDDDECHKEGWRPLLDSIPETD

MGNCLVMEKKVIKIVRDDGKVLEYREPISVHHILTQFSGHSISHNNTHLLPDAKLLSGRL
YYLLPTTMTKKKVNKKVTFANPEVEGDERLLREEEDSSESNSNIDGDDTKNVTVVRMKIV
VHKQELEKLLQGGSVHEMMYQTLEKQLLLTSSDDDDLECNSGWRPALDSIPESESLRRT

www.000webhost.com

Other information
Ka divergence:0.113085KaKs divergence:-0.999527
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):522Length 2 (bp):540Length divergence:0.017
MFE 1 (kcal):-136.5MFE 2 (kcal):-150.84MFE divergence0.05