Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10200-AT5G04060
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein
Function (paralog2):S-adenosyl-L-methionine-dependent methyltransferases superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.5758130005129
Log2 mRNA fold difference:2.5426058726259
Log2 TE fold difference:-1.4844329415243
Sequences
Protein sequence

MRGSVIGAERSGQTIMVALVLMVGSFYTGSLFGTNQPIYVSHPSSHSASSKFANKIELTY
RRLPLVIPESGMNVCPLEFNEYIPCHNVTYVHQLLPSLNLSRREDLERHCPPLEHRLFCL
VPPPNDYKIPIRWPTSRDYVWRSNVNHTHLAQVKGGQNWVHEQGQFWWFPGGGTHFKHGA
AEYIQRLGNMMTNETGDLRSAGVVQVLDVGCGVASFAAYLLPLGIQTISFAPKDGHENQI
QFALERGIGAMISAVATKQLPYPAASFEMVHCSRCRVDWHTNDGILLKEVHRLLRPNGFF
VYSSPPAYRKDKEYPMIWDKLVNLTSAMCWKLISRKVQTAIWIKEEKEVCLKQKAELKLI
SLCDVEDVLKPSWKVPLKDCVQISGQTEERPSSLAERLSAYPATLRKIGISEDEYTSDTV
FWREQVNHYWRLMNVNETEVRNVMDMNAFIGGFAAAMNSYPVWVMNIVPATMNDTLSGIF
ERGLNGAFHDWCEAFSTYPRTYDLVHSDHVFSHYNKSYGDGCLLEDIMLEMDRIVRPQGF
VIIRDEEYIISRIRGLAPKFLWEVETHELENKDKKITESVLFCRKRFWAII

MGGGYVLFGSARSGQMIMVALVLMVGSFYAGSIFGNNSPIYISQPSSSNSSSSSPSQSGP
SNFANKIELTYRRTSVSIPESGVNVCPLKFNEYIPCHNVTYVQQLLPSLNLSRREELERH
CPPLEQRLFCLVPPPKDYKIPIRWPTSRDYVWRSNVNHTHLAEVKGGQNWVHEQGQLWWF
PGGGTHFKHGAPEYIQRLGNMTTNETGDLLSAGVEQVLDVGCGVASFAAYLLPLGIKTMS
FAPKDGHENQIQFALERGIRAMISAIATKQMPYPAASFDMVHCSRCRVDWHENDGVLMKE
VNRLLRPNGYFVYSAPPAYRKDKDFPVIWDKLVNLTSAMCWKLISRKVQTAIWVKEDDEA
CLRKNAELELITICGVEDVSKASWKVPLRDCVDISENRQQKPSSLTDRLSSYPTSLREKG
ISEDEFTLDTNFWREQVNQYWELMNVNKTEVRNVMDTNAFIGGFAAAMNSYPLWVMNVVP
ATMNDTLSGIYQRGLTGAYHDWCEPFSTYPRTYDLLHADHLFTHYKIYGEGCLLEDIMLE
MDRIIRPQGFIIIRDEESIVSRVRDLAPKFLWEVEAHELQDKYKKTETVLFCRKKFWAIL

www.000webhost.com

Other information
Ka divergence:-0.0328459KaKs divergence:-0.0992953
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1776Length 2 (bp):1803Length divergence:0.008
MFE 1 (kcal):-536.71MFE 2 (kcal):-546.37MFE divergence0.009