Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10250-AT5G04090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant protein 1589 of unknown function
Function (paralog2):Plant protein 1589 of unknown function

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.027780009043063
Log2 mRNA fold difference:0.0034943245129168
Log2 TE fold difference:0.15419557546956
Sequences
Protein sequence

MSSGTVRRVSRQDIQLVQNLIERCLQLYMNQKEVVDTLLEQAKIEPGFTELVWQKLEEEN
REFFKAYYLRLMVKHQIMEFNKLLEQQVHHMRQMHPTGVASVQNTNGSHLQSMNQKQLCY
PSEHTDQSLKSESAHHPMASSLSNAFLNGSSTLNTNVPSSINISTHARRVDASPNMLSSQ
TTNMPMMQGMNGGMIKSETAFTNPASFMYGGERNALEGHSAVGDTSIPNFSNESNNQPLS
DPLLEAEASTFGFLGQIPRNFSLSDLTADFSQSSEILESYDRSPFLVPNAENFLDSRDRG
EYQGDNKRLDTISEGFSYDNIGSE

MSSLTVRRVSREDIQLVQNLIERCLQLYMNQKEVVDTLLEQAKIEPGFTELVWQKLEEEN
REFFKAYYLRLMVKHQIMEYNELLEQQINHMRQMHPTAGASVRNRNGSHVPPMNQQQLLY
ERKEPDQSSPNLSSPYLNGGSAINTNIPSYVDFSSHSRRVDPSPNSLSLQATNMPLMQGM
IKSETAYQNCAPYMYGGEAQSTVGDVTIASFSNDSSNQSLNDPLVDPDAPTFGSLGQIPQ
NFSLSDLTADFSQSSDILESYEGSPFLLADAENFLDSSERVEHQGDHERLRTISSGFSYE
NFRSN

Other information
Ka divergence:0.386694KaKs divergence:0.363878
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):975Length 2 (bp):918Length divergence:-0.03
MFE 1 (kcal):-268.04MFE 2 (kcal):-256.01MFE divergence-0.023