Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10270-AT5G04130
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DNA GYRASE B1
Function (paralog2):DNA GYRASE B2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.57261991742515
Log2 mRNA fold difference:-0.13768789286815
Log2 TE fold difference:-0.47989754146001
Sequences
Protein sequence

MSLTVTINSSMALVQRQHSYLLRYFRLMASRPRPRLFSHSLYPSLHRHSSALSSSTPRIK
FQLANVFSQRLVQRNAVSPKSFMSSTMESLQESSTSKDYSSEHIQVLEGLDPVRKRPGMY
IGSTGSRGLHHLVYEILDNAIDEAQAGFASKIDVVLHSDDSVSISDNGRGIPTDLHPATG
KSSLETVLTVLHAGGKFGGKSSGYSVSGGLHGVGLSVVNALSEALEVIVRRDGMEFQQKY
SRGKPVTTLTCHVLPPESRGTQGTCIRFWPDKEVFTTAIQFDHNTIAGRIRELAFLNPKV
TISLKKEDDDPERDVYSEYFYAGGLTEYVSWLNTDKKPLHDVLGFRKEINGSTVDVSLQW
CSDAYSDTMLGYANSIRTIDGGTHIEGVKASLTRTLNSLAKKLKVIKVKGYIIYSSPWIE
TKFKYSSALKRHALRTINNEKDISLSGEHVREGLTCIVSVKVPNPEFEGQTKTRLGNPEV
RKIVDQSVQEYLTEYLELHPDVLESIISKSLNAYKAALAAKRARELVRSKSVLKSSSLPG
KLADCSSTDPAESEIFIVEGDSAGGSAKQGRDRRFQAILPLRGKILNIERKDEAAMYKNE
EIQNLILGLGLGVKGEDFNKENLRYHKIIILTDADVDGAHIRTLLLTFFFRYQRALFDAG
CIYVGVPPLFKVERGKQAHYCYDDAALKKITASFPGNASYNIQRFKGLGEMMPAQLWETT
MNPDTRILKQLVVDDAAETNMVFSSLMGARVDVRKELIKSAATRMNLENLDI

MALLQRASYLRLYYLRLMGSRPRLFSSSLSPALHRHSSTLSSPPFSSPSPSFRLKFQLTS
VLSQRLIQRNAISSRFLSTEASQETTTSKGYSSEQIQVLEGLDPVRKRPGMYIGSTGSRG
LHHLVYEILDNAIDEAQAGYASKVDVVLHADGSVSVVDNGRGIPTDLHPATKKSSLETVL
TVLHAGGKFGGTSSGYSVSGGLHGVGLSVVNALSEALEVSVWRDGMEHKQNYSRGKPITT
LTCRVLPLESKGTKGTSIRFWPDKEVFTTAIEFDHNTIAGRIRELAFLNPKVTISLKKED
DDPEKTQYSEYSFAGGLTEYVSWLNTDKNPIHDVLGFRREINGATVDVALQWCSDAYSDT
MLGYANSIRTIDGGTHIEGVKASLTRTLNTLAKKSKTVKEKDISLSGEHVREGLTCIVSV
KVPNPEFEGQTKTRLGNPEVRKIVDQSVQEYLTEFLELHPDILESIISKSLNAYKAALAA
KRARELVRSKSVLKSSSLPGKLADCSSTDPEVSEIFIVEGDSAGGSAKQGRDRRFQAILP
LRGKILNIERKDEAAMYKNEEIQNLILGLGLGVKGEDFKKENLRYHKIIILTDADVDGAH
IRTLLLTFFFRYQRALFDAGCIYVGVPPLFKVERGKNAQYCYDDADLKKITSNFPANASY
NIQRFKGLGEMMPEQLWETTMNPETRILKQLVVDDIAEANMTFSSLMGARVDVRKELIKN
AATRINLQRLDI

www.000webhost.com

Other information
Ka divergence:0.115896KaKs divergence:0.156832
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):2319Length 2 (bp):2199Length divergence:-0.027
MFE 1 (kcal):-677.45MFE 2 (kcal):-656.81MFE divergence-0.015