Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10290-AT5G04160
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-sugar transporter family protein
Function (paralog2):Nucleotide-sugar transporter family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:3.5485491456588
Log2 mRNA fold difference:2.0313575606971
Log2 TE fold difference:1.463149614526
Sequences
Protein sequence

MSSHARGKELIPLLSFSHQKKQPNLSISSTTKMNKKNPDQKSDMSSSSSSPKKQTLFISS
LIILWYTSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYVSIVFLKLVPLQYLKS
RSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTALFAYIMTFKREAWVT
YGALVPVVTGVVIASGGEPGFHWFGFIMCISATAARAFKSVLQGILLSSEGERLNSMNLM
LYMSPIAVIALLPVTIFMEPDVMSVTLTLGRQHKYMYILLLVNSVMAYSANLLNFLVTKH
TSALTLQVLGNAKGAVAVVISILLFRNPVTVMGIGGYSITVLGVVAYGETKRRFR

MSSSAKKQTLFISTLIISWYSSNIGVLLLNKFLLSNYGFKFPIFLTMCHMSACAILSYIS
IVFLKLVPLQHLKSRSQFLKVATLSIVFCASVVGGNISLRYLPVSFNQAVGATTPFFTAL
FAYLMTFKREAWVTYGALVPVVAGVVIASGGEPGFHWFGFIMCISATAARAFKSVLQGIL
LSSEGEKLNSMNLMLYMSPIAVIALLPVTLFMEPDVISVTLTLAKQHQYMWILLLVNSVM
AYSANLLNFLVTKHTSALTLQVLGNAKGAVAVVISILIFQNPVTVMGIGGYSITVLGVVA
YGETKRRFR

www.000webhost.com

Other information
Ka divergence:-0.0101548KaKs divergence:0.210687
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1068Length 2 (bp):930Length divergence:-0.069
MFE 1 (kcal):-283.29MFE 2 (kcal):-243MFE divergence-0.077