Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10300-AT5G04170
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Calcium-binding EF-hand family protein
Function (paralog2):Calcium-binding EF-hand family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.95381744284006
Log2 mRNA fold difference:0.62819237434942
Log2 TE fold difference:-1.7033046132087
Sequences
Protein sequence

MSGYPPSSQGYGYGGNPPPPQPPYGSTGNNPPPYGSSGSNPPPPYGSSASSPYAVPYGAQ
PAPYGAPPSAPYASLPGDHNKPHKEKPHGASYGSPSPGGYGAHPSSGPSDYGGYGGAPQQ
SGHGGGYGGAPQQSGHGGGYGAPPPQASYGSPFASLVPSAFPPGTDPNIVACFQAADRDN
SGFIDDKELQGALSSYNQSFSIRTVHLLMYLFTNSNVRKIGPKEFTSLFFSLQNWRSIFE
RFDKDRSGRIDTNELRDALMSLGFSVSPVILDLLVSKFDKSGGRNRAIEYDNFIECCLTV
KGLTEKFKEKDTALSGSAIFNYENFMLTVLPFLVA

MSGYPPTSQGYGYGYGGGNQPPPPQPPYSSGGNNPPYGSSTTSSPYAVPYGASKPQSSSS
SAPTYGSSSYGAPPPSAPYAPSPGDYNKPPKEKPYGGGYGAPPPSGSSDYGSYGAGPRPS
QPSGHGGGYGATPPHGVSDYGSYGGAPPRPASSGHGGGYGGYPPQASYGSPFASLIPSGF
APGTDPNIVACFQAADQDGSGFIDDKELQGALSSYQQRFSMRTVHLLMYLFTNSNAMKIG
PKEFTALFYSLQNWRSIFERSDKDRSGRIDVNELRDALLSLGFSVSPVVLDLLVSKFDKS
GGKNRAIEYDNFIECCLTVKGLTEKFKEKDTAYSGSATFNYESFMLTVLPFLIA

www.000webhost.com

Other information
Ka divergence:-0.238201KaKs divergence:0.0206412
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):1008Length 2 (bp):1065Length divergence:0.027
MFE 1 (kcal):-347.9MFE 2 (kcal):-358.8MFE divergence0.015