Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10340-AT5G04230
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):phenylalanine ammonia-lyase 4
Function (paralog2):phenyl alanine ammonia-lyase 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6965106375179
Log2 mRNA fold difference:0.89526360093472
Log2 TE fold difference:0.82969304918199
Sequences
Protein sequence

MELCNQNNHITAVSGDPLNWNATAEALKGSHLDEVKRMVKEYRKEAVKLGGETLTIGQVA
AVARGGGGSTVELAEEARAGVKASSEWVMESMNRGTDSYGVTTGFGATSHRRTKQGGALQ
NELIRFLNAGIFGPGAGDTSHTLPKPTTRAAMLVRVNTLLQGYSGIRFEILEAITKLLNH
EITPCLPLRGTITASGDLVPLSYIAGLLTGRPNSKAVGPSGETLTASEAFKLAGVSSFFE
LQPKEGLALVNGTAVGSGLASTVLFDANILAVLSEVMSAMFAEVMQGKPEFTDHLTHKLK
HHPGQIEAAAIMEHILDGSSYVKEAQLLHEMDPLQKPKQDRYALRTSPQWLGPQIEVIRA
ATKMIEREINSVNDNPLIDVSRNKALHGGNFQGTPIGVAMDNSRLAIASIGKLMFAQFSE
LVNDFYNNGLPSNLSGGRNPSLDYGFKGAEIAMASYCSELQFLANPVTNHVQSAEQHNQD
VNSLGLISSRKTAEAVDILKLMSTTYLVALCQAVDLRHLEENLKKAVKSAVSQVAKRVLT
VGANGELHPSRFTERDVLQVVDREYVFSYADDPCSLTYPLMQKLRHILVDHALADPEREA
NSATSVFHKIGAFEAELKLLLPKEVERVRVEYEEGTSAIANRIKECRSYPLYRFVRDELN
TELLTGENVRSPGEEFDKVFLAISDGKLIDPLLECLKEWNGAPVSIC

MEFRQPNATALSDPLNWNVAAEALKGSHLEEVKKMVKDYRKGTVQLGGETLTIGQVAAVA
SGGPTVELSEEARGGVKASSDWVMESMNRDTDTYGITTGFGSSSRRRTDQGAALQKELIR
YLNAGIFATGNEDDDRSNTLPRPATRAAMLIRVNTLLQGYSGIRFEILEAITTLLNCKIT
PLLPLRGTITASGDLVPLSYIAGFLIGRPNSRSVGPSGEILTALEAFKLAGVSSFFELRP
KEGLALVNGTAVGSALASTVLYDANILVVFSEVASAMFAEVMQGKPEFTDHLTHKLKHHP
GQIEAAAIMEHILDGSSYVKEALHLHKIDPLQKPKQDRYVLGYALRTSPQWLGPQIEVIR
AATKMIEREINSVNDNPLIDVSRNKAIHGGNFQGTPIGVAMDNTRLALASIGKLMFAQFT
ELVNDFYNNGLPSNLSGGRNPSLDYGLKGAEVAMASYCSELQFLANPVTNHVESASQHNQ
DVNSLGLISSRTTAEAVVILKLMSTTYLVALCQAFDLRHLEEILKKAVNEVVSHTAKSVL
AIEPFRKHDDILGVVNREYVFSYVDDPSSLTNPLMQKLRHVLFDKALAEPEGETDTVFRK
IGAFEAELKFLLPKEVERVRTEYENGTFNVANRIKKCRSYPLYRFVRNELETRLLTGEDV
RSPGEDFDKVFRAISQGKLIDPLFECLKEWNGAPISIC

Other information
Ka divergence:0.692141KaKs divergence:0.434588
GC content 1 (%):49GC content 2 (%):49GC content divergence:0
Length 1 (bp):2124Length 2 (bp):2097Length divergence:-0.006
MFE 1 (kcal):-726.12MFE 2 (kcal):-705.66MFE divergence-0.014