Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10440-AT5G04320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Shugoshin C terminus
Function (paralog2):Shugoshin C terminus

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:2.7718521778044
Log2 mRNA fold difference:3.0764313291391
Log2 TE fold difference:-0.3072060048741
Sequences
Protein sequence

MVRATVLNVGDHASEGVRTNKAKGEKMVLEPPMNSAQRRKLGDITNLQNQKNLMNQGAKH
QQQAILISSKENAENLQKENTKLMKVVMERDGIKSDLKKLRIEFQKVQEQNLLLAQANTR
ILAEFNTSKDQLKVLQHELGCKNGLVMARKMLLKEQTLPCTRHASKVKAQANACGGACKT
FQPNDADHEHASGSSNANSLQRNEKANSKRRVSGRKNPANSEVLDIIGRSGETCQMEDNI
DNKKLVSDSDNDAENHINDNVQSKRYCAGRQSSSSKTREASQTETLQKVVDAKEIKGDAR
FSLTKHSDWLKSQEPEPSESLYESRFPLRRRSARLKSQEPEPSESFHDSIETTKRRRSAI
RSAMFNIQELGVIQNLNGLPDDQEIAAKARCSAREQSTGSKPEAVEPHDTKEIIGKSRIS
LRRQSARFNFQELGVTENLNGPHDDQTIAANARCCASEQSIGSKPEAVEPHDIEERIGKI
RVSSRRQSANIETPRAIKEPANPPLHDDNVEESSQISCSVSMELKRESKKKPTGDESEEM
RKTTVGRPSRQAAEKIKSYKEPSLKEKMRGGF

MVLTEMSLDYSNRVLGSQKDNVKQMDKEETQQKENMLFSSQEYAAKLQKENMTLMKALAH
RNKLVELSGIEIQKLRINLRSVQEKNLQLAQANSQMLAELNTNRDRLKDLQHELGCKNAL
LKVKKHLEEQVLPRTHHESKDKVSASASDGDCKSFQVHDIKHKDTKRKRTTRIKSSVSAD
VKPIPVNDSNSKANRKRRVSGVIDTTGIPEEICQTEDDIDKGVVSRGVNQDIDNVVNKKF
VPDAANPVKESVHRKRQCTRRQSTRFDVQETKQTEKLLEMDGAKESKETASFSLRRRSAR
LRHEEAEPCKSLHEGDEVRETIKRRRVSLRLSARFDIQEPHVTETSNADDARSIVIEESA
GSRSESVEPSESRHETKEITRKRSFSTRRQSTKGKSQTDEAIKEIATDPSLVNTIVQECD
QETESKDKPKADENEGMTRRSSVGRPSRHAAEKVQSYREVSLRVKMRRKC

www.000webhost.com

Other information
Ka divergence:0.0297237KaKs divergence:0.0284876
GC content 1 (%):43GC content 2 (%):41GC content divergence:-0.024
Length 1 (bp):1719Length 2 (bp):1413Length divergence:-0.098
MFE 1 (kcal):-488.24MFE 2 (kcal):-362.52MFE divergence-0.148