Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10480-AT3G10490
Species:Arabidopsis
Duplication type:TD
Function (paralog1):NAC domain containing protein 50
Function (paralog2):NAC domain containing protein 52

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.029192487470795
Log2 mRNA fold difference:-0.30361122870217
Log2 TE fold difference:0.33735360550759
Sequences
Protein sequence

MGRESLAVVSSPPSATAPSTAVSATSLAPGFRFHPTDEELVSYYLKRKVLGKPVRFDAIG
EVDIYKHEPWDLAEKILCSYLALNCFKNFVFACATVMFACATVMFALFSKLKTRDQEWYF
FSALDKKYGNGARMNRATNKGYWKATGKDREIRRDIQLLGMKKTLVFHSGRAPDGLRTNW
VMHEYRLVEYETETNGSLLQDAYVLCRVFHKNNIGPPSGNRYAPFMEEEWADGGGALIPG
IDVRVRVEALPQANGNNQMDQWADLLKLHNSIKFAITFCRTQLNLTALSNERCSTREIFI
VFWLICKEMHSASKDLININELPRDATPMDIEPNQQNHHESAFKPQESNNHSGYEEDEDT
LKREHAEEDERPPSLCILNKEAPLPLLQYKRRRQNESNNNSSRNTQDHCSSTITTVDNTT
TLISSSAAAATNTAISALLEFSLMGISDKKENQQKEETSPPSPIASPEEKVNDLQKEVHQ
MSVERETFKLEMMSAEAMISILQSRIDALRQENEELKKKNASGQAS

MGRESVAVVTAPPSATAPGTASVATSLAPGFRFHPTDEELVSYYLKRKVLGQPVRFDAIG
EVDIYKHEPWDLAVFSRLKTRDQEWYFYSALDKKYGNGARMNRATNRGYWKATGKDREIR
RDILLLGMKKTLVFHSGRAPDGLRTNWVMHEYRLVEYETEKNGNLVQDAYVLCRVFHKNN
IGPPSGNRYAPFMEEEWADDEGALIPGIDVKLRLEPPPVANGNDQMDQEIQSASKSLINI
NEPPRETAPLDIESDQQNHHENDLKPEEHNNNNNYDENEETLKREQMEEEERPPRPVCVL
NKEAPLPLLQYKRRRQSESNNNSSRNTQDHCSSTTTTVDNTTTLISSSAAATNTAISALL
EFSLMGISDKKEKPQQPLRPHKEPLPPQTPLASPEEKVNDLQKEIHQMSVERETFKLEMM
SAEAMISILQSRIDALRQENEELKKNNANGQ

www.000webhost.com

Other information
Ka divergence:0.621747KaKs divergence:0.999829
GC content 1 (%):45GC content 2 (%):48GC content divergence:0.032
Length 1 (bp):1581Length 2 (bp):1356Length divergence:-0.077
MFE 1 (kcal):-483.06MFE 2 (kcal):-399.79MFE divergence-0.094