Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10525-AT5G04470
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LOSS OF GIANT CELLS FROM ORGANS
Function (paralog2):cyclin-dependent protein kinase inhibitors

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-1.0820232724439
Log2 mRNA fold difference:-1.7194052560287
Log2 TE fold difference:0.59428295049077
Sequences
Protein sequence

MDLELLQDLSKFNFPTPIKIRSKTSKTKKDEGDDDEDDLRCSTPTSQEHKIPAVVDSPPP
PPRKPRPPPSAPSATAALMIRSCKRKLLVSTCEIIMNREEIDRFFSSVYNETSTTAKRRR
SYPYCSRR

MDLDLIQDLPILNFPPAIKIRANTNRDDDGGGCTTPTSSDHKIPPTTATTPPPPPQKPRP
PSTPSSLGIRSCKRKLMTSLSKYEIIVNKDEIERFFSSVYNQTMASSTTTAITVAKRRRS
FRSCSRR

www.000webhost.com

Other information
Ka divergence:-0.0820481KaKs divergence:0.775457
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):387Length 2 (bp):384Length divergence:-0.004
MFE 1 (kcal):-103.85MFE 2 (kcal):-104.21MFE divergence0.002