Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10540-AT5G04510
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):3-phosphoinositide-dependent protein kinase
Function (paralog2):3'-phosphoinositide-dependent protein kinase 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.3774174375277
Log2 mRNA fold difference:-0.051929643298424
Log2 TE fold difference:-0.33754665785548
Sequences
Protein sequence

MLTMDKEFDSKLTLQGNSSSNGETISRSKSFAFKAPQENFTYHDFELGKIYGVGSYSKVV
RAKKKDNGTVYALKIMDKKFITKENKTAYVKLERIVLDQLEHPGIVKLFFTFQDTQSLYM
ALESCEGGELFDQITRKGRLSEDEARFYSAEVVDALEYIHNMGLIHRDIKPENLLLTLDG
HIKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALG
CTLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTDPSRRPGAGS
EGYDSLKRHPFFKGVDWKNLRSQTPPKLAPDPASQSASPERDGSPWNPTHVGDTSVLQND
GHNGLSESSGSITRLASIDSFDSRWQQFLEPGESVLMISAVKKLQKITSKKVQLILTNKP
RLIYVDPSKLVVKGNIIWSDNSNDLNVQVSSPSHFKICTPKKVLSFEDAKQRALQWKKAI
ETLQNR

MLAMEKEFDSKLVLQGNSSNGANVSRSKSFSFKAPQENFTSHDFEFGKIYGVGSYSKVVR
AKKKETGTVYALKIMDKKFITKENKTAYVKLERIVLDQLEHPGIIKLYFTFQDTSSLYMA
LESCEGGELFDQITRKGRLSEDEARFYTAEVVDALEYIHSMGLIHRDIKPENLLLTSDGH
IKIADFGSVKPMQDSQITVLPNAASDDKACTFVGTAAYVPPEVLNSSPATFGNDLWALGC
TLYQMLSGTSPFKDASEWLIFQRIIARDIKFPNHFSEAARDLIDRLLDTEPSRRPGAGSE
GYVALKRHPFFNGVDWKNLRSQTPPKLAPDPASQTASPERDDTHGSPWNLTHIGDSLATQ
NEGHSAPPTSSESSGSITRLASIDSFDSRWQQFLEPGESVLMISAVKKLQKITSKKVQLI
LTNKPKLIYVDPSKLVVKGNIIWSDNSNDLNVVVTSPSHFKICTPKKVLSFEDAKQRASV
WKKAIETLQNR

www.000webhost.com

Other information
Ka divergence:0.0663085KaKs divergence:0.0208193
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):1461Length 2 (bp):1476Length divergence:0.005
MFE 1 (kcal):-417.12MFE 2 (kcal):-425.55MFE divergence0.01