Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10550-AT5G04540
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Myotubularin-like phosphatases II superfamily
Function (paralog2):Myotubularin-like phosphatases II superfamily

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.65475369202909
Log2 mRNA fold difference:-0.35545240002544
Log2 TE fold difference:1.0096277372496
Sequences
Protein sequence

MTPPRPPSGRVRSLRDYSSESEKMDGTGSWDTLEWTKLDSTSGSGSFSNLSCLLESERVI
VEGYGVVLINTDEAGTLLVTNFRILFLSEGTRKVIPLGTIPLATIEKFNKMVLKVQSSPR
QSDKIPPRRLLQVTGKDMRIIVYGFRPRTKQRRNVFDALLKCTKPERVWDLYTFACGPSK
FGNANPKERLLNEYFRLLGKSSIRASMDMIEDGAFTLSNELWRISDLNSNYNLCQTYPFA
FMIPKSISDAELLQACSFRARCRLPVITWCQPGSGAVIARSSQPLVGLMMNMRSNLDEKL
VAAFCSQLPGAKGERRKLYIADARPRKNALANGAMGGGSESSSNYFQSEIVFFGIDNIHA
MRESFSRVRDYLDMHGTTSSDGRSSFLRHGGWTWGGGNLSSMSASVSLLGDSGWLIHIQS
VLAGAAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYRTFAGFQALVEKDWL
AFGHPFSDRVGMPNISGSGNFDFPRQSSSAGSFPSSPVRQSSGSAASQSSSSSHGHNNYS
PIFMQWIDSVSQLMRMYPCAFEFSPTFLVDFMDCLLSCRFGNFLCNSEKEREQCGIADAC
GCLWAYLTDLRSFSATSHVHCNPFYDPLKYDGPLLPPAASLAPTLWPQFHLRWACPEEAK
AADIGVQCRAMTVKYSEMQKEKEAAERRVDEISFAMESLSAELLRERHLSWVARESANRA
TKEYAALTRAVQSLGCKINFTTSDVEDDPRSSLENNPRRRNRHGNNSDVSVSISLMPEEN
TSGNPKGRVCEALCPLRTREGVCRWPEVGCAHVGSQFVGLKANFDAFDRLAIYDSYFQPK

MTALRPLSGRSRSLRCSSEKMEGTGSWDVLEWTKLDSASWSGSYSNLDCLLESERIIFEA
CGVILINTDEAGTLLLSNFRILFLSEGTRKLVPLGTIPFVAIEKFNKLAPKVQSNKYHNN
ENAPTRLLQVTGKDMRIVVYGFRPGTKQRHTVVDTLLRCNKPERVWDLYAFTCGPSQFGN
TNPKERLLNEYFRLLGKSSQRASMNMIEDGSFTLSNDLWRITNLNSNYDLCQSYPFALMV
PKSISDEELLQTSTFRARCRLPVISWCHPGSGAVIARSSQPLVGLMMNMRSNSDEKLVAS
FCTQLAGHKGARRKLYIVDARPRKNALANGAKGGGSESSSNYLQSEIVFLGIDNIHAMRE
SFSRLRDYLDMHGTTSSDGTSSFLRHGGWTWGGGNLSSMSASVSVLGDSGWLSHIQSILA
GVAWIAARVAMESASVLVHCSDGWDRTTQLVSLACLLLDPYYRTFSGFQALVEKDWLSFG
HPFSDRVGMPNVSESGNFELPIQSSSARSFPSSPVRQSPGSAAAQSSSSSYGLNNYSPIF
LQWLDCISQLMRMYPSAFEFSPTFLVDFIDCLLSCRFGNFLCNSEKERQQCGISETCGCI
WAYLADLRSSSGTSHVHCNPFYDPSRYDGPLLPPAAALAPTLWPQFHLRWACPVEPNVTE
TEDQCRAMTVKYSEMKKEKEEAERKVDELSSAMESLNEELLNERDISRAARESAKRATKE
RAVISRAVQSLGCKVKFTRNGDCTVEVEDGPQKCSHSIPQKQSEDNTTDVSESISSVTEQ
NVCEAVCPLRTREGTCRWPDAGCARIGNQFLGLKTNFEAFDNLCVYDSYFTAE

www.000webhost.com

Other information
Ka divergence:0.394921KaKs divergence:0.0853637
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):2523Length 2 (bp):2502Length divergence:-0.004
MFE 1 (kcal):-789.58MFE 2 (kcal):-769.63MFE divergence-0.013