Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10560-AT3G10570
Species:Arabidopsis
Duplication type:TD
Function (paralog1):Cytochrome P450 superfamily protein
Function (paralog2):cytochrome P450, family 77, subfamily A, polypeptide 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.68362657238736
Log2 mRNA fold difference:0.10125179057752
Log2 TE fold difference:0.58478216609499
Sequences
Protein sequence

MSFLSFSPISLDLLSSNVFLTILAIIISGLLKTITYRKHNSNHLNLPPGPPGWPVIGNLF
QFTRSGKQFFEYVEDLVKIYGPILTLRLGTRTMIIISDASLAHEALIERGAQFATRPVET
PTRKIFSSSEITVHSAMYGPVWRSLRRNMVQNMLSSNRLKEFGSVRKSAMDKLIERIKSE
ARDNDGLVWVLQNSRYAAFCVLLDICFGVEMEEESIEKMDQLMTAILNAVDPKLHDYLPI
LTPFNYNERNRALKLRRELVDFVVGFIEKRRKAIRTATVSSFSYLDTLFDLRIIEGSETT
PSDEDLVTLCSEFLNAGTDTTGAAIEWGIAELIANPEIQSRLYDEIKSTVGDRAVDERDV
DKMVLLQAVVKEILRRHPPTYFTLSHGVTEPTTLSGYNIPVGVNIEFYLPGISEDPKIWS
EPKKFDPDRFLSGREDADITGVAGVKMMPFGVGRRICPGMGMATVHVHLMIARMVQEFEW
LAYPPQSEMDFAGKLVFAVVMKKPLRAMVRPRVQ

MSILSFPHTFFNISPSLFYTILISSLVLLILTRRSAKSKIVKLPPGPPGWPVVGNLFQFA
RSGKQFYEYVDDVRKKYGPIYTLRMGSRTMIIISDSALVHDVLIQRGPMFATRPTENPTR
TIFSSNTFTVNASAYGPVWRSLRKNMVQNMLSSIRFREFGSLRQSAMDKLVERIKSEAKD
NDGLVWVLRNARFAAFCILLEMCFGIEMDEESILNMDQVMKKVLITLNPRLDDYLPILAP
FYSKERARALEVRCEQVDFIVKLIERRRRAIQKPGTDKTASSFSYLDTLFDLKTEGRITT
PSNEELVSLCSEFLNGGTDTTGTAIEWGIAQLIVNPEIQSRLYDEIKSTVGDREVEEKDV
DKMVFLQAVVKEILRKHPPTYFTLTHSVTEPTTVAGYDVPVGINVEFYLPGINEDPKLWS
DPKKFNPDRFISGKEEADITGVTGVKMMPFGIGRRICPGLAMATVHVHLMLAKMVQEFEW
SAYPPESEIDFAGKLEFTVVMKKPLRAMVKPRV

www.000webhost.com

Other information
Ka divergence:-0.185799KaKs divergence:-0.32811
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1545Length 2 (bp):1542Length divergence:-0.001
MFE 1 (kcal):-518.18MFE 2 (kcal):-510.83MFE divergence-0.007