Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10600-AT5G04770
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):cationic amino acid transporter 7
Function (paralog2):cationic amino acid transporter 6

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.6118489880668
Log2 mRNA fold difference:1.1770587064853
Log2 TE fold difference:-0.427858231029
Sequences
Protein sequence

MEAQYRNHDGDTSFSSLRVYLNSLSDTPSRFSRRAVSVSTSYDEMSRVRAVSGEQMRRTL
RWYDLIGLGIGGMIGAGVFVTTGRASRLYAGPSIVVSYAIAGLCALLSAFCYTEFAVHLP
VAGGAFSYIRITFGEFPAFITGANLIMDYVLSNAAVSRGFTAYLGSAFGISTSEWRFIVS
GLPNGFNEIDPIAVIVVLAVTFVICYSTRESSKVNMVLTALHIAFIVFVIVMGFSKGDVK
NLTRPDNPENPSGFFPFGVSGVFNGAAMVYLSYIGYDAVSTMAEEVKDPVKDIPMGISGS
VAIVIVLYCLMAISMSMLLPYDLIDAEAPYSAAFSKSEGWEWVTRVVGIGASFGILTSLI
VAMLGQARYMCVIGRSRVVPIWFAKVHPKTSTPVNASAFLGIFTAVLALFTDLNVLLNLV
SIGTLFVFYMVANAVIFRRYVTVGYTEPWPTLSFLCLFSITSILFTLVWQLAPSGPPKWF
ILGASTVTAIAIVQIFHCVVPQARIPEFWGVPLMPWTPCVSIFLNIFLLGSLDAPSYIRF
GFFSGLVVLVYVFYSVHASYDAEGDGSLDFKDVESLERINRVLS

MEVQSSSNNGGHSSFSSLRVYLNSLSATPSRLSRRAISVSTSSDEMSRVRAVSGEQMRRT
LRWYDLIGLGIGGMVGAGVFVTTGRASRLDAGPSIVVSYAIAGLCALLSAFCYTEFAVHL
PVAGGAFSYIRITFGEFPAFFTGANLVMDYVMSNAAVSRSFTAYLGTAFGISTSKWRFVV
SGLPKGFNEIDPVAVLVVLVITVIICCSTRESSKVNMIMTAFHIAFIFFVIVMGFIKGDS
KNLSSPANPEHPSGFFPFGAAGVFNGAAMVYLSYIGYDAVSTMAEEVENPVKDIPVGVSG
SVAIVTVLYCLMAVSMSMLLPYDLIDPEAPFSAAFRGSNGWEWVTKVVGIGASFGILTSL
LVAMLGQARYMCVIGRSRVVPFWFAKIHPKTSTPVNASTFLGIFTAALALFTDLNVLLNL
VSIGTLFVFYMVANALIFRRYVPVGPTKPWPTLCFLTLFSITSLVFTLIWKLVPEGKPKA
FMLGASAVVAIAIVLSFQCVVPQARKPELWGVPFMPWTPCVSIFLNIFLLGSLDAPSYVR
FGFFSGLIVLVYLFYGVHASSDAEANGSFGVKDGQVMKELIEV

www.000webhost.com

Other information
Ka divergence:0.0890392KaKs divergence:-0.0058427
GC content 1 (%):50GC content 2 (%):51GC content divergence:0.01
Length 1 (bp):1755Length 2 (bp):1752Length divergence:-0.001
MFE 1 (kcal):-561.47MFE 2 (kcal):-582MFE divergence0.018