Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10640-AT5G04850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SNF7 family protein
Function (paralog2):SNF7 family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.13552275544066
Log2 mRNA fold difference:0.25110841801749
Log2 TE fold difference:-0.39532999000651
Sequences
Protein sequence

MRRVFGAKKNTEPPPSIQDASDRINKRGDSVEDKIKKLDVELCKYKEQLKKTRPGPAQEA
VKARAMRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTMTALKSANKELKGMM
KTVKIQDIDNLQDEMMDLMDVSSEIQESLGRSYNIPDGLDEDDLMGELDALEADMGNETE
ADGMPSYLQPDTETDYDSELNLPAAPTGHNGAPHGRAQAEDEFGLPAVPRASLRG

MKRIFGAKNNKEPPPSIQDASDRINKRGDSVEEKVKRLDAELCKYKDQIKRTRPGPALEA
IKARAMRVLKQKKMYEGQRDMLYNQTFNLDQVSFAAEGLKDAQQTMTALKSANKELKGMM
KTVKIQDIDNLQDDMMDLMDESSEIQETLGRSYNVPDDIDEDDLLGGKFFLCSLCCLSLG
LVETISLCLLNSAPYTLYRFVNSELDALEADMGNETEADGVPSYLQPDKEPDLNDELNLP
SAPMGHTGAPPGRAQAEDEWGLPAVPRASLRG

www.000webhost.com

Other information
Ka divergence:-0.078608KaKs divergence:0.074593
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):708Length 2 (bp):819Length divergence:0.073
MFE 1 (kcal):-198MFE 2 (kcal):-233.62MFE divergence0.083