Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10660-AT5G04870
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):calmodulin-domain protein kinase cdpk isoform 2
Function (paralog2):calcium dependent protein kinase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.7418023280674
Log2 mRNA fold difference:1.805154095892
Log2 TE fold difference:0.90674169378517
Sequences
Protein sequence

MGNACVGPNISGNGFLQTVTAAMWRPRIGAEQASSSSHGNGQVSKEAASEPATDQVQNKP
PEPITMPSSKTNPETKLKPDLEIQPEEKKEKVLAEETKQKVVPEESKQEVPPEESKREVV
VQPESAKPETKSESKPETTKPETTSETKPETKAEPQKPKHMRRVSSAGLRTESVLQRKTE
NFKEFYSLGRKLGQGQFGTTFLCLEKGTGNEYACKSISKRKLLTDEDVEDVRREIQIMHH
LAGHPNVISIKGAYEDVVAVHLVMELCSGGELFDRIIQRGHYTERKAAELARTIVGVLEA
CHSLGVMHRDLKPENFLFVSREEDSLLKTIDFGLSMFFKPDEVFTDVVGSPYYVAPEVLR
KRYGPESDVWSAGVIVYILLSGVPPFWAETEQGIFEQVLHGDLDFSSDPWPSISESAKDL
VRKMLVRDPKRRLTAHQVLCHPWVQIDGVAPDKPLDSAVLSRMKQFSAMNKFKKMALRVI
AESLSEEEIAGLKQMFKMIDADNSGQITFEELKAGLKRVGANLKESEILDLMQAADVDNS
GTIDYKEFIAATLHLNKIEREDHLFAAFSYFDKDESGFITPDELQQACEEFGVEDARIEE
MMRDVDQDKDGRIDYNEFVAMMQKGSIMGGPVKMGLENSISISLKH

MGNTCVGPSRNGFLQSVSAAMWRPRDGDDSASMSNGDIASEAVSGELRSRLSDEVQNKPP
EQVTMPKPGTDVETKDREIRTESKPETLEEISLESKPETKQETKSETKPESKPDPPAKPK
KPKHMKRVSSAGLRTESVLQRKTENFKEFYSLGRKLGQGQFGTTFLCVEKTTGKEFACKS
IAKRKLLTDEDVEDVRREIQIMHHLAGHPNVISIKGAYEDVVAVHLVMECCAGGELFDRI
IQRGHYTERKAAELTRTIVGVVEACHSLGVMHRDLKPENFLFVSKHEDSLLKTIDFGLSM
FFKPDDVFTDVVGSPYYVAPEVLRKRYGPEADVWSAGVIVYILLSGVPPFWAETEQGIFE
QVLHGDLDFSSDPWPSISESAKDLVRKMLVRDPKKRLTAHQVLCHPWVQVDGVAPDKPLD
SAVLSRMKQFSAMNKFKKMALRVIAESLSEEEIAGLKEMFNMIDADKSGQITFEELKAGL
KRVGANLKESEILDLMQAADVDNSGTIDYKEFIAATLHLNKIEREDHLFAAFTYFDKDGS
GYITPDELQQACEEFGVEDVRIEELMRDVDQDNDGRIDYNEFVAMMQKGSITGGPVKMGL
EKSFSIALKL

www.000webhost.com

Other information
Ka divergence:-0.190794KaKs divergence:0.314072
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1941Length 2 (bp):1833Length divergence:-0.029
MFE 1 (kcal):-570.19MFE 2 (kcal):-577.61MFE divergence0.006