Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10680-AT5G04890
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):HSP20-like chaperones superfamily protein
Function (paralog2):HSP20-like chaperones superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.7355537119795
Log2 mRNA fold difference:0.22781730242501
Log2 TE fold difference:1.8628612961173
Sequences
Protein sequence

MAAIFKRPRPGGGRHPPPLAPTVSSFKPRAQWTNSGSSIFLYVNLPGFYRDQIEIKKDER
TRTVQIQGQRPLSAQTKARFSEAYRVPDTCDMTKLSTSFSHGLLTIEFPAIVEANKQEKA
VQDQEKIGQRSNQEKSGGPGPNGSTLGRKKALEEEKQVGTSQEKTTPTLNEEAPKTYKSV
VEGKRAVPTGSQEKSEAKVKAREAIPSLGGRERAKEEKVVERKEAAHIVQQKIGDKLKEE
EAKSTPTLGGSLKPKVQAKEEKVIERKKDDDISQLKTGQKVKEKEISRTPTIDARVESKE
HAKVVEKKEDGEIGQKLEGGRINLGPKKEDKFTKPVVGDEARRIEKNVAQRNQAEPKLKT
KEGDERIKLDVDDGVRNKQDENNEMVGDMVSEGEIQDRVEQKKIDEAGLAKDRGDLKDNA
EVVEPETGPLLVKEGQKKSDMDPPLAVGGRGMGEEESRTYDIPLVNVGVAALVIMGFGAY
VFVPLVKYFS

MAARQQQKGTGFGVQYEDFVPKSEWKDQPEATILNIDLTGFAKEQMKVTYVHSSKMIRVT
GERPLANRKWSRFNEVFTVPQNCLVDKIHGSFKNNVLTITMPKETITKVAYLPETSRTEA
AALEKAAKLEEKRLLEESRRKEKEEEEAKQMKKQLLEEKEALIRKLQEEAKAKEEAEMRK
LQEEAKAKEEAAAKKLQEEIEAKEKLEERKLEERRLEERKLEDMKLAEEAKLKKIQERKS
VDESGEKEKILKPEVVYTKSGHVATPKPESGSGLKSGFGGVGEVVKSAEEKLGNLVEKEK
KMGKGIMEKIRRKEITSEEKKLMMNVGVAALVIFALGAYVSYTFCSSSSSSSSSSPSSSS
SSTKPE

Other information
Ka divergence:-0.263448KaKs divergence:-0.390094
GC content 1 (%):45GC content 2 (%):44GC content divergence:-0.011
Length 1 (bp):1473Length 2 (bp):1101Length divergence:-0.145
MFE 1 (kcal):-403.56MFE 2 (kcal):-329.54MFE divergence-0.101