Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10720-AT5G04970
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Plant invertase/pectin methylesterase inhibitor superfamily
Function (paralog2):Plant invertase/pectin methylesterase inhibitor superfamily

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-1.6296247607488
Log2 mRNA fold difference:-0.67517351654789
Log2 TE fold difference:-0.95112308745831
Sequences
Protein sequence

MKMQTLNFTSSLLFLSFIFLSCALLISSQQSPSQPHSEPPSQLPFEPPVESPFFPPSQPP
IFVPPSQPPSLPPSQSQSPSLACKSTPYPKLCRTILNAVKSSPSDPYRYGKFTIKQCLKQ
ASRLSKVITSYARRVESKPGSATAEEIGAVADCGELSELSVNYLETVTTELKTAQVMTAA
LVEHVNSLLSGVVTNQQTCLDGLVEAKSGFAAAIGSPMGNLTRLYSISLGLVSHALNRNL
KRFKASKGKILGGGNSTYREPLETLIKGLRKTCDNDKDCRKTSRNLGELGETSGGSILVS
KAVIVGPFKSDNFTTITDAIAAAPNNTRPEDGYFVIYAREGVYEEYIVVPINKKNLMLMG
DGINKTIITGNHNVVDGWTTYNCSSFAVVGERFMAVDVTFRNTAGPEKHQAVALRNNAEG
SSFYRCSFEGYQDTLYVHSLRQFYRECDIYGTVDFIFGNAAAIFQNCNIYARKPMAKQKN
AITAHGRLDPNQNTGISIINCTIKAAPDLAAEPKSAMTFLGRPWKPYSRTVFMQSYISDI
VQPVGWLEWNGTIGLDTIYYGEYSNFGPGANTNQRVQWLGYNLLNLAEAMNFTVYNFTMG
DTWLPQTDIPFYGGLLSKE

MQTHSSSLVFLALLCLSWALLVSPTRPPSQPPSHPPIQPSSQPPTQPPSQPPTQPPTQPP
SHPPTQPPTPPPSQSPSQPSPLPPNIACKSTPYPKLCRTILSAVKSSPSDPYHYGKFTMK
QCLKQARRLSKVINRFAQRVEADPGTSTVEEVSAVADCGELAELSVEYLETVTEELKAAE
LMTAALVDRVTSLLGGVVTNQQTCLDGLVDAKSGFATAIGTPLGNLTRLYSVSLGLVSHA
LNRNLKRYKGSKGKIFGGGNKPVREPLETLIKVLRKTCDKGKDCRKANRNLGELGETSGG
SILVREAVTVGPYETDNFPTITEAVAAAPNHTFPEQGYFVIYARAGLYEEYVVISNKKRN
IMLIGDGINKTIISGNHSFIDGWTTYNSSTFAVVGDRFVAVDVTFRNTAGPEKHQAVAVR
NNADGSTFYRCSFEGYQDTLYVHSLRQFYRECDIYGTIDFIFGNAAAIFQNCNIYARKPM
ANQKNAVTAHGRTDPNQKTGISIINCTIGAAPDLAADPKSTMTFLGRPWKPYSRTVYIQS
YISDVVQPVGWLEWNGTTGLDTISYGEYDNFGPGADTSKRVQWSGYSLLNLVQAMNFTVY
NFTLGDTWLPQTDIPFYGGLLHTE

www.000webhost.com

Other information
Ka divergence:-0.00349063KaKs divergence:-0.838874
GC content 1 (%):47GC content 2 (%):48GC content divergence:0.011
Length 1 (bp):1860Length 2 (bp):1875Length divergence:0.004
MFE 1 (kcal):-562.78MFE 2 (kcal):-583.11MFE divergence0.018