Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10730-AT5G04990
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):SAD1/UNC-84 domain protein 2
Function (paralog2):SAD1/UNC-84 domain protein 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.81707638977775
Log2 mRNA fold difference:0.70142400051199
Log2 TE fold difference:0.11837399585367
Sequences
Protein sequence

MSASTVSITASPRTIRRTPVLSGEKKSNFDFPPSESHANAAIGESSAGTNKDLIRAEAAG
ERSNTYDVGPVTRKSGSTATGTNTTTTQRRTRKSQGNKIDRGKWKTVVRVFAKQFGALLL
LVGLIQLIRKLTLKDSSLSSSNFPIETEMVLSELESRISAVDGLVKTTTKMMQVQVEFLD
KKMDSESRALRQTIDSTSSVLHSELKKVESKTERLQVSVDELNAKPLVSREELERVYEEL
KKGKVGDSDVNIDKLRAYARDIVEKEIGKHVADGLGRVDYALASGGAFVMGHSDPFLVGN
GRNWFGTSRRRVHSKAVKMLTPSFGEPGQCFPLKGSNGYVLVRLRAPIIPEAVTLEHVSK
AVAYDRSSAPKDCRVSGWLGDIDMETETMPLLTEFSYDLDRSNAQTFDIADSAHSGLVNT
VRLDFNSNHGSSSHTCIYRFRVHGRELDSVSVAHA

MSASTVSITANTAAATRRTPILAGEKKSNFDYPQSESLANGGVGEAGGTSRDLSRGEATL
DRSQGQDLGPVTRRSVSAATGTNTTATQRRTRKVATPKSEKARWKTVVRIFAKQLGALLI
IVGLIQLTRKMILKASSPSSPISSYETEMAFSGLESRIAEVDGLVKATTNSMQVQVELLD
KKMEREAKVLRQEIERKASAFQSELKKIESRTESLEKSVDEVNAKPWVTKDELERIYEEL
KKGNVDDSAFSEISIDELRAYARDIMEKEIEKHAADGLGRVDYALASGGAFVMEHSDPYL
VGKGSSWFATTMRRAHTNAVKMLSPSFGEPGQCFPLKGSEGYVQIRLRGPIIPEAFTLEH
VAKSVAYDRSSAPKDCRVSGSLQGPESSAETENMQLLTEFTYDLDRSNAQTFNILESSSS
GLIDTVRLDFTSNHGSDSHTCIYRFRVHGRAPDPVPVVGTNLDQDSSPESE

www.000webhost.com

Other information
Ka divergence:-0.0952271KaKs divergence:-0.671684
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1368Length 2 (bp):1416Length divergence:0.017
MFE 1 (kcal):-440.01MFE 2 (kcal):-463.5MFE divergence0.026