Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10760-AT5G05090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Homeodomain-like superfamily protein
Function (paralog2):Homeodomain-like superfamily protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.9317124113575
Log2 mRNA fold difference:-2.5547518808304
Log2 TE fold difference:1.6071461254567
Sequences
Protein sequence

MREDDSDWFARWEEELPSPEELMPISQSLISPDLALAFDIRTPNHGNGNSNQPHHHHHHQ
TTPPTPSQLQLPSSQANSSAEFAADSADLGSGGAAGDEPARTLKRPRLVWTPQLHKRFVD
AVAHLGIKNAVPKTIMQLMSVDGLTRENVASHLQKYRLYLKRMQGLSSGGGAGSDPATDR
LFASSPVPAHFLHPNRVPSSDHFMPSFVPIATLQQQQQMAAAAAAAAAANPHLQPPQFHR
QIAAAHFGSPTNGGFSSPTSNGQFGSPTSNGFGSPTTNGKFDPSFLAVRQTQQQPIQRMS
TPSLHSPVSNYVEDLESANANGGRTVLTLFPTRDD

MREEDSNWFAKWEEELPSPEELIPLSQSLITPDLAIAFDLHRNNNSNSGQPLPQTTPPQP
NSSAEIAGDSTGDEPARTLKRPRLVWTPQLHKRFVDAVAHLGIKNAVPKTIMQLMSVDGL
TRENVASHLQKYRLYLKRMKSGGGGGGSGDSDHLFASSPVPPHFLHPTSRQSSDLFIPSF
VPISTQQQHIAAPPSQFLHRQISAVNFTSPTKATDQAMFLARQQSELQQPVFKPSSLHLH
SQVANYTQDLKSGAKTVLTLFPTRDD

www.000webhost.com

Other information
Ka divergence:0.343053KaKs divergence:-0.12812
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):1008Length 2 (bp):801Length divergence:-0.114
MFE 1 (kcal):-295.32MFE 2 (kcal):-199.43MFE divergence-0.194