Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10770-AT5G05100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Single-stranded nucleic acid binding R3H protein
Function (paralog2):Single-stranded nucleic acid binding R3H protein

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:0.9063060756554
Log2 mRNA fold difference:-0.29367500786896
Log2 TE fold difference:1.1833066771121
Sequences
Protein sequence

MASMTEKEAMVDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFPPFPTSYLRLA
AHRVAQHYGLVTMALDNGTGAGDGSDNRILVTKTAESRFPYVCLSEIPVKQPENGRPEGF
KIAIKPRPKRGSGCGGSGSGVQQNLLRSVEERKEEYDKARARIFNSPSSSDSEDSSSLRP
PSLEVRNTCINRNETEVAVNNSPVDAVTRDSGRTSRVAIIRDREKDRYDPDYDRSYDRYV
VDPAYRYVRVMPSGQSFSPMPIHIPFHDGFFPHMPRGHQANLNYGHPLNPALSPFTHNVA
SYTPWPNSPVMNYAQPLNGSDTNLYRYPSASNP

MAAMSDKEAMVDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLI
AHRVAQHYGLFTTALEGGGVDGSGNRILATKTVESRYPYVCLSEIPVKQPEIHGRPEGFK
IAIKPRPNRGAGGSGSGSGVEKNLLRSVEERKEEYDKARARIFNSPSSSDSEDSSTRAPP
PPYPRLDSKHNTACPSRNETEVVVNYNSNPVDVERNGVIRDSGRTSRVAIIRDREKDRYD
PDYDRNRYVRVAPPVQNFNPIPIPLPFHDAIFPQMPRTQASLNYGHPLNPAMTAPSYTEW
PSATMTYAQTLNASDVHHFRHPNP

www.000webhost.com

Other information
Ka divergence:0.301073KaKs divergence:0.243041
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):1002Length 2 (bp):975Length divergence:-0.014
MFE 1 (kcal):-307.33MFE 2 (kcal):-296.59MFE divergence-0.018