Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10820-AT5G05140
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Transcription elongation factor (TFIIS) family protein
Function (paralog2):Transcription elongation factor (TFIIS) family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.9155974428669
Log2 mRNA fold difference:1.3063431782768
Log2 TE fold difference:-0.11290692978275
Sequences
Protein sequence

MAKMRPSVSLDTWREYFRRGDSDIFGIIDHAIMVAAADWPKEFKSRSDRIAELLFSCKVS
RCIGCDHLELSIAGDEAAVEIVGVGGGGDRGDSGVATGEGEEASVSVDEVMRIRDILSNK
DDEKDSVLLESLRKLESMSMSVDILKDTEIGKAVNGLRRHSSDKISKLAKTLFAEWKRLV
DQWMNTPEEMAGTEGTPESLNLSVIDEEEAFPSPPHDLDIYAPEPNGFELSQILDCLDCD
GNPRHSVESKHERKSQSSAGRRPKGTNDANVVGRYCNDQQTRREEADVRPMKHSATDVVE
PKRQTKQSREQMVSAIQRKPTAVTEQKRKLAGPQQDKLKALDPDSKFEFAKRKLQESYHQ
HENAKRQRTIQVLETIPKQNKVQKPQLKRPATRRYIYWYFWSSEFPGYELPSLILNLANP
RDSSSQFSRHDELMIDIPVYFGLVLVQIDKAEMVDEMMIFKKMSVLLTEKDFVDAIVSVS
LKDLTRSLFVRFEAKACPKFDLIHKTSVETVRCVGKTFMHMLSKVSREFPPRNRTHPGGL
LYQRFDPTHLSLARQQVAICKETDSQYPHEIVIHWTSASA

MKASGSLDSWREYFRRRGDSDIFGIIDHAIMVAATDCPNKFKSRRDKIAELLFSCRVNRC
VGCDHLELSVPGDDEANRGTTGNGGGGTAVDEDYEVAGGSKESKANSSRGDNNQIVSNYT
FDEAEALSDEIEEFSVVSKEVARIKEILLNKEDEPNSVLLDSLRHLKLMSLNVDILKSTE
IGKAVNGLRKHSSDKIRQLAKTLIAEWKELVDQWVNTTKEITGAEGTPESANPSVLDEEE
AFPSLPYDVDIFTPEPNGFEISHFFDSLDFDGNPRNSEEHNTSREHERRPQNIAKRKPEG
TQMRIQDAPFRSIKPSSATDFDGTRRPVKQSTEQRMKNETVSVHKSEKPMIQRKPVVTEQ
KRKAPGPQQEKLKGLDADAKFEFAKRKLQESYQHHENAKKQRTIQVLEMIPKQGSAQKPQ
LKRPGMSNRNWANGRK

www.000webhost.com

Other information
Ka divergence:-0.292414KaKs divergence:0.102634
GC content 1 (%):45GC content 2 (%):43GC content divergence:-0.023
Length 1 (bp):1743Length 2 (bp):1311Length divergence:-0.141
MFE 1 (kcal):-534.26MFE 2 (kcal):-370.17MFE divergence-0.181