Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10860-AT5G05370
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Cytochrome b-c1 complex, subunit 8 protein
Function (paralog2):Cytochrome b-c1 complex, subunit 8 protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.2448221567555
Log2 mRNA fold difference:-1.6513977242087
Log2 TE fold difference:-0.59823556633447
Sequences
Protein sequence

MGKQPVKLKAVVYALSPFQQKIMTGLWKDLPEKIHHKVSENWISATLLVTPVVGTYWYAQ
YFKEQEKLEHRF

MGKQPVKLKAVVYALSPFQQKIMTGLWKDLPEKIHHKVSENWISTILLVAPVVGTYSYAQ
YFKEQEKLEHRF

www.000webhost.com

Other information
Ka divergence:0.0968396KaKs divergence:-0.999972
GC content 1 (%):50GC content 2 (%):48GC content divergence:-0.02
Length 1 (bp):219Length 2 (bp):219Length divergence:0
MFE 1 (kcal):-64.8MFE 2 (kcal):-60.2MFE divergence-0.037