Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G10980-AT5G05350
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):PLAC8 family protein
Function (paralog2):PLAC8 family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-4.5034639416566
Log2 mRNA fold difference:-4.0190297392715
Log2 TE fold difference:-0.48850897357171
Sequences
Protein sequence

MGSNCDGNLKAEIEESNGSSGKNTKVPPCPLDVSTSRRTLIGDGKPRRWSISALPDASSR
FQLLKFGSPSAKFKKMAEDRDEVSRSVTSSSNGSSHNFRERISGVLHRKIDWSSLMNMGK
EWIRNPINMALFVWILVVAVSGAILFMVMTGMLNHALPKKSQRDAWFEVNNQILNGLFTL
MCLYQHPKRFYHLVLLCRWKHDDITKLRKAYCKDGTYKPNEWMHIMVVVILLHLNCFAQY
ALCGLNVGYRRSERPPIGVAICISAAIGAPAVAGLYTILSPLGKDYNDSNEDEENQLKQR
EEGSVNRRFTLERRYSFASASTGVGDGMVPVSDPQWSGGILDIWDDISLAYLSLFCTFCV
FGWNMERVGFGNMYVHIATFILFCLAPFFIFNLAAVNIDNETVREALGISGILLCVFGLL
YGGFWRIQMRKRFKLPSYNFCFGRAAIADCALWLCCCWCSLAQEVRTANSYEIVEDKFCQ
RKEEKNMVSPNLVSPLPREDGVFDPRFGLGSSPKNISGASSPSPSRFWKEAHSPNVQTPR
EKEEVKSDVALTPPSPLSIHREA

MGSVDEVEISKTRVSCPPALSTSHKILISEEKPRRWSESSLPDVSNRIKLLKFGSPSARL
KRMAEERDEVSRSVNSSSSSSHDVVSSRKIEWACLMKMGKQWLQNPLNMVMFLWIFVVAV
SGAILFMVMTGMLNHALPKKSQRDVWFEVNNQILNALFTLMCLYQHPKRFYHLVLLCRWK
QDDVTTLRKIFCKNGTYKPNEWIHMMVVVLLLHLNCFAQYALCGLNLGYRRSERPAIGVA
ICISFAIAAPTAAGLYTILSPLGKDYDPQGDEENQVQAVGEGPVSNRKLSLERRYSFASN
DVSNPEWREGVLDIWEDISLAYLSLFCTFCLFGWNMERIGFGNMYVHIATFVLFCLAPFF
IFNLAAINIDNEMVRDALGYTGIVLCLFGLLYGGFWRIQMRKRFKLPGYNICCGRPAIAD
CTLWLFCCWCSLAQEVRTANSYEIVEDKFCKRREENSKIDDEVVVSALPREDGVFDPSCL
PKKMTTTMIASSTLSPSRQKDETCLGEKGDEALSPPSPPFIHREAS

www.000webhost.com

Other information
Ka divergence:0.173572KaKs divergence:0.450587
GC content 1 (%):41GC content 2 (%):42GC content divergence:0.012
Length 1 (bp):1692Length 2 (bp):1581Length divergence:-0.034
MFE 1 (kcal):-506.65MFE 2 (kcal):-475.71MFE divergence-0.031