Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11040-AT5G05460
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Glycosyl hydrolase family 85
Function (paralog2):Glycosyl hydrolase family 85

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:3.4570598793259
Log2 mRNA fold difference:2.8722435356649
Log2 TE fold difference:0.51243339989936
Sequences
Protein sequence

MPKSNDDDVAQSEAVPLLDLVKPSLPISFPIKALQDLKSRSYFDSFHFQFNRSTVPFRRN
SDCLPNRPRVLVCHDMKGGYVDDKWVQGCENEAGFAIWHWYLMDIFVYFSHSLVTIPPPC
WTNTAHRHGVKVLGTFITEWDEGKATCKEMLATKESAQMYAERLAELATALGFDGWLINI
ENDIDEEQIPNMKEFVSHLKKVLHLSTPGALVIWYDSVTVRGNLQWQDQLTELNKPFFDL
CDGIFMNYTWKESYPNLSAEVAGDRKFDVYMGIDVFGRGSFGGGQWTVNAALDLLKRNNV
SAAIFAPGWVYETAQPPNFHTAQNKWWSLVEKSWGIVQTYPQVLPFYSDFNQGFGYHVSL
EGRQLSDSPWYNISCQSLQPLLEFNEDNKDIIQVTVDQEGKNVFDFSEQHLNNYYEYDSA
REASFNGGGNIVFRGKLKGDAYFTTRLFKPHLQLSSSPITISYSVKSDETSNLGILLSFS
SPSLETKSILVAPEDPIRRFDDMSLQCLTTSVQTVSEWTVHEASLVMDGHTLTEISAFCY
RPENSTKSAEFVALLGHISVKDHVQNQQNPEILLPASSWVIEAHNVELVPGNSSSKILRV
KLEWRQKDLEDSAFTRYNVYAENVKSTDLRPRKVLEKPKSETVLLGIAHVPAYYVAELVV
ESDVKAVRFMVQACGEDASLGKLDEALNLLVDLEGLSVNHD

MSVAPPAPSPPPFDPTKPSTPISFPIKTLQDLKSRSYFDSFHYPFNRSSVPLRRNIGALS
DRPRLLVCHDMKGGYVDDKWVQGCGNNAGYAIWDWYLMDVFVYFSHSLVTLPPPCWTNTA
HRHGVKVLGTFITEWDEGKATCKELLATKESAQMYAERLAELAAALGFDGWLINIENVID
EVQIPNLMVFVSHLTKVMHSSVPGGLVIWYDSVTIDGHLAWQDQLTENNKPFFDICDGIF
MNYTWKENYPKASAEIAGDRKYDVYMGIDVFGRGTYGGGQWTANVALDLLKSSNVSAAIF
APGWVYETEQPPDFYTAQNKWWSLVEKSWGIVQTYPQVLPFYSDFNQGLGSHTSLGGRKL
SEAPWYNISCQSLQPFLEFNEGRNSETIQVTVDGREASYNGGGNVSFRGKLKRNAHFTAR
LFKPQLQLSAAPISIFFSVKSDKRSELSILLHFSSPSQEKKSMLMVPNESINRFGDMFLP
CLLTSKQTTSGWTVHETNLVLDGHTLTEISAFCSRPDDLTEETNTLEYFALLGHISIKSQ
QKAKVYPLASSWVIEAHHVKFVPGDSGSKTLSCKLEWRLKHPEEDSVFPKYNVYAENLSS
SEYRPRKVMEEPRSEKVFLGTAHVDAYYVSEMVVGSDVKGVRFVVQTCGEDGSWQELDAS
PNLVVEVERVSSKLCCCGLI

www.000webhost.com

Other information
Ka divergence:-0.121257KaKs divergence:-0.322985
GC content 1 (%):44GC content 2 (%):43GC content divergence:-0.011
Length 1 (bp):2106Length 2 (bp):2043Length divergence:-0.015
MFE 1 (kcal):-618.33MFE 2 (kcal):-612.17MFE divergence-0.005