Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11070-AT5G05520
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Outer membrane OMP85 family protein
Function (paralog2):Outer membrane OMP85 family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.78905608985581
Log2 mRNA fold difference:-0.40086726445022
Log2 TE fold difference:-0.20148006668651
Sequences
Protein sequence

MANPTENLDANPQIREPEAEEEVEELNGYEGDDGGEDDDGEDDDTESKSQTRESGSSVDR
IKAESLFRRMRAAPVPVRVHDVIIGGNEKTKDHIIEAEVDAVREATTLQELLEASRVANS
NLRALDIFDSVNITLDSGPPELPGTTNVVIDVVESKSPLTGQIGAYTRAEARSSSVEASL
KYKNIFGYGDIWDGSIVYGCDNSAEVGLGMYLPRFRGLSTPFTSRLFLSTQDWLKFSSYK
ERSLGLSLGLFSSKYHELIYTIAWRNLIDPSQAAAVSIRRQLGHSLLSALKYTFRFDQRN
SSLRPTNGYAFISTSQIGGLAPDSRSLRFLKQEVDLRYAVPFGFYNAAINFGVSGGVSFP
WGSGYQNRPSSIPERFFLGGNSSPVCSLSGPSALWGFKTRGVGPSEPKRKGDSERDFVGG
DAAVTAFADLSFDLPVRWLRERGIHGHVFACAGNMAKLSENEFRNFTAPKFLETFRTSVG
AGIVLPTSLFRMELNYCHILKKQEHDQARSGVFLTFSASS

MENPAEKPDPNPSKPKIESEDEREELGDINGDEEEEEEYEEEDDGKPRTREDAIADRIKA
ESLFRRMRATPVAVRVHDVIVKGNEKTKDHVIEAEVDVVRQATTLQELLKASKVANFNLQ
ALDIFDSVKITLDSGPPELPGTTNVVIDVVESKSPITGQIGTFTKAEARSSSLEGSLKYK
NIFGYGDIWDGSLAYGCDHSAEVGLGMYLPRFRGRPTPFTSRVYLSTQDWLKFSSYKERA
LGLSLGLIASKYHELAYNIAWRNLIDPSQMASRSIRRQLGHNLVSALKYTFKFDQRNSSL
RPTRGYSFISTSQIGGLAPDSRTLRFLRQEIDLRYAVPLGFYRAALNFGIAGGITFPWGS
GYKSRASCVPERFFLGGNISPVCSLGGPSALWGFKTRGLGPNEPRREVQDDESGDTYERD
FVGGDVAVTAFADLSFDFPLKWFRDRGIHGHVFACAGNMAELSENKYRNFTAPKLLETFR
SSVGAGIVVPTSLFRMELNYCHILKKQEHDRAKSGFFMTFSTSS

www.000webhost.com

Other information
Ka divergence:-0.19382KaKs divergence:-0.281159
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1563Length 2 (bp):1575Length divergence:0.004
MFE 1 (kcal):-509.7MFE 2 (kcal):-493.19MFE divergence-0.016