Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11100-AT5G05550
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):sequence-specific DNA binding transcription factors
Function (paralog2):sequence-specific DNA binding transcription factors

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.70700059895994
Log2 mRNA fold difference:-1.2799065781622
Log2 TE fold difference:0.46842975516938
Sequences
Protein sequence

METTPETQSKTHRLPAGREDWWSEDATATLIEAWGDRYVNLNRGNLRQNDWKEVADAVNS
SHGNGRPKTDVQCKNRIDTLKKKYKTEKAKPLSNWCFFDRLDFLIGPVMKKSSGAVVKSA
LMNPNLNPTGSKSTGSSLDDDDDDDDDDEEDDDDAGDWGFVVRKHRKVEDVDSSEGSAFR
ELARSILKLGEAFERIEGKKQQMMIELEKQRMEVAKELELQRMNMLMEMQLELEKSKLGK
RRAASGKKL

METTTPQSKSSVSHRPPLGREDWWSEEATATLVEAWGNRYVKLNHGNLRQNDWKDVADAV
NSRHGDNSRKKTDLQCKNRVDTLKKKYKTEKAKLSPSTWRFYNRLDVLIGPVVKKSAGGV
VKSAPFKNHLNPTGSNSTGSSLEDDDEDDDEVGDWEFVARKHPRVEEVDLSEGSTCRELA
TAILKFGEVYERIEGKKQQMMIELEKQRMEVTKEVELKRMNMLMEMQLEIEKSKHRKRAS
ASVVWQGKV

www.000webhost.com

Other information
Ka divergence:0.297722KaKs divergence:0.275419
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):750Length 2 (bp):750Length divergence:0
MFE 1 (kcal):-215.5MFE 2 (kcal):-219.24MFE divergence0.009