Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11170-AT5G05580
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):fatty acid desaturase 7
Function (paralog2):fatty acid desaturase 8

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.7069350105851
Log2 mRNA fold difference:-2.2128242426634
Log2 TE fold difference:0.65350883251915
Sequences
Protein sequence

MANLVLSECGIRPLPRIYTTPRSNFLSNNNKFRPSLSSSSYKTSSSPLSFGLNSRDGFTR
NWALNVSTPLTTPIFEESPLEEDNKQRFDPGAPPPFNLADIRAAIPKHCWVKNPWKSLSY
VVRDVAIVFALAAGAAYLNNWIVWPLYWLAQGTMFWALFVLGHDCGHGSFSNDPKLNSVV
GHLLHSSILVPYHGWRISHRTHHQNHGHVENDESWHPMSEKIYNTLDKPTRFFRFTLPLV
MLAYPFYLWARSPGKKGSHYHPDSDLFLPKERKDVLTSTACWTAMAALLVCLNFTIGPIQ
MLKLYGIPYWINVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGLINNIH
HDIGTHVIHHLFPQIPHYHLVEATEAAKPVLGKYYREPDKSGPLPLHLLEILAKSIKEDH
YVSDEGEVVYYKADPNLYGEVKVRAD

MASSVLSECGFRPLPRFYPKHTTSFASNPKPTFKFNPPLKPPSSLLNSRYGFYSKTRNWA
LNVATPLTTLQSPSEEDTERFDPGAPPPFNLADIRAAIPKHCWVKNPWMSMSYVVRDVAI
VFGLAAVAAYFNNWLLWPLYWFAQGTMFWALFVLGHDCGHGSFSNDPRLNSVAGHLLHSS
ILVPYHGWRISHRTHHQNHGHVENDESWHPLPESIYKNLEKTTQMFRFTLPFPMLAYPFY
LWNRSPGKQGSHYHPDSDLFLPKEKKDVLTSTACWTAMAALLVCLNFVMGPIQMLKLYGI
PYWIFVMWLDFVTYLHHHGHEDKLPWYRGKEWSYLRGGLTTLDRDYGWINNIHHDIGTHV
IHHLFPQIPHYHLVEATEAAKPVLGKYYREPKNSGPLPLHLLGSLIKSMKQDHFVSDTGD
VVYYEADPKLNGQRT

www.000webhost.com

Other information
Ka divergence:-0.068032KaKs divergence:-0.362168
GC content 1 (%):43GC content 2 (%):44GC content divergence:0.011
Length 1 (bp):1341Length 2 (bp):1308Length divergence:-0.012
MFE 1 (kcal):-370.22MFE 2 (kcal):-382.31MFE divergence0.016