Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11200-AT5G05610
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):alfin-like 2
Function (paralog2):alfin-like 1

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.28178514671071
Log2 mRNA fold difference:-0.045206219486912
Log2 TE fold difference:-0.23483476286342
Sequences
Protein sequence

MAAAAVSSNPRTVEEIFKDYSARRAALLRALTKDVDDFYSQCDPEKENLCLYGHPNESWE
VNLPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSFYFGARLNRNERK
RLFSLINDLPTLFDVVTGRKAMKDNKPSSDSGSKSRNGTKRSIDGQTKSSTPKLMEESYE
EEEEEDEHGDTLCGSCGGHYTNEEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPPCC
AKKGRQ

MAAESSNPRTVEEIFKDFSGRRSGFLRALSVDVDKFYSLCDPEMENLCLYGHPNGTWEVN
LPAEEVPPELPEPALGINFARDGMQRKDWLSLVAVHSDCWLLSVSSYFGARLNRNERKRL
FSLINDLPTLFEVVTGRKPIKDGKPSMDLGSKSRNGVKRSIEGQTKSTPKLMEESYEDED
DEHGDTLCGSCGGNYTNDEFWICCDVCERWYHGKCVKITPAKAESIKQYKCPSCCTKKGR
Q

www.000webhost.com

Other information
Ka divergence:0.205911KaKs divergence:0.162116
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):741Length 2 (bp):726Length divergence:-0.01
MFE 1 (kcal):-223.8MFE 2 (kcal):-220.4MFE divergence-0.008