Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11240-AT5G05700
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):arginine-tRNA protein transferase 2
Function (paralog2):arginine-tRNA protein transferase 1

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.4322080293829
Log2 mRNA fold difference:0.55683889980677
Log2 TE fold difference:0.81277151635641
Sequences
Protein sequence

MSSKKAKTKNEASSSRGGIGGESIVADCGRNKSTCGYCKSSTRFSISHGLWTERLTVNDY
QALLDSGWRRSGCYLYKPEMEKTCCPSYTIRLKASDFVPSKEQQRVRRRIERFLDGELDA
KPSEQTEDQDVSFSREVSVSVKKSLGAAKREKNNELEPIMKDLSEQIDNAVQKCIQSGEF
PSNVQIPKASVKKVFSAKRKKLAEGSEDLLYTSNIAFPIVAAMKHTQTLEKGKNVEENRL
SPEAVSEKLLSAMNKVGEFTGFSVKVSKGHINFLSATQVTSSDRNEGEESLCATTIKSSS
NKLHARKRKLEMHLKRSSFEPEEYELYKRYQMKVHNDKPESISETSYKRFLVDTPLTEVP
SSGYDDEEKIPLCGFGSFHQQYRVDDRLIAVGVIDILPKCLSSKYLFWDPDFASLSLGNY
SALQEIDWVKQNQAHCSTLEYYYLGYYIHSCNKMRYKAAYRPSELLCPLRYQWVPFEVAK
PLLDKKPYSVLSNISKVSSSSSSPQASETLLESTSEHEDMEQGDTNDDDDEMYNSDEDSD
SDSSSSRNRSDITNILISLNGPRLRYKDIPRFKNPVVQKQLESMLVSYRKVVGAELSEIM
VYELR

MSLKNDASSSHDGGSNRESVIDDHGRRKSTCGYCKSPARSSISHGLSAQTLTVYDYQALI
DRGWRRSGTYLYKHEMDKTCCPPYTIRLKASDFVPTKEQQRVSRRLERFLDGKLDVQPRE
QRGASSSGDVSDTRRKTLGAAKSEENKKVEAVMDDLSKNIDQAVQLCIRSGEFPSNMQIP
KASVKKVFCARRKKLAEGTEQILYTSNIAFPIAAAIKRIQTSEKEGINSAEGNRLSPETI
SEMLLSAMHKVGETPDVSIKVCKGHINFLSSAKDSFSDRDVVPNGNISRGANSLDGSETL
HAKKDSENHQARKRKLEIHLKRSSFDPEEHELYKRYQLKVHNDKPGHVVESSYRRFLVDS
PLIDVQPSGDEKVPPCGFGSFHQQYRIDGRLIAVGVVDILPKCLSSVYLFWDPDYAFLSL
GKYSAIQEINWVIENQARCPSLQYYYLGYYIHSCSKMRYKAAYRPSELLCPLRFQWVPFE
VARPMLDKKPYVILSDIAISHNQCSLLAGASETLVEPAASEHEDMEQGETNDNFMGCSDE
DEDEDEDDDDDDDDDEEMYETESEDSHIESDPGSKDNDINNILIGLYGSQYRYKEMRQII
TPVGRKQLEPMLQSYRKVVGAELSERMVYEIN

Other information
Ka divergence:-0.0375656KaKs divergence:0.219174
GC content 1 (%):41GC content 2 (%):41GC content divergence:0
Length 1 (bp):1818Length 2 (bp):1899Length divergence:0.022
MFE 1 (kcal):-521.45MFE 2 (kcal):-546.57MFE divergence0.024