Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11270-AT5G05780
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Mov34/MPN/PAD-1 family protein
Function (paralog2):RP non-ATPase subunit 8A

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:2.1393178473899
Log2 mRNA fold difference:1.7758334773012
Log2 TE fold difference:0.39538878805742
Sequences
Protein sequence

MDVIKTQQISARTIEKVIVHPLVLLSIVDHYNRVAKDTSKRVVGVLLGSSSRGTVDVTNS
YAVPFEEDDKDTSIWFLDHNYHESMFHMFKRINAKEHIVGWYSTGPKLRENDLDVHALFN
GYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQQVFVHVPTEIAAHEVEEIGV
EHLLRDVKDTTISTLATEVTAKLTALKGLDARLREIRTYLDLVIEGKLPLNHEILYHLQD
VFNLLPNLNVNELVKAFAVKTNDMMLVIYLSSLIRSVIALHSLINNKLLNKEHEKAEDSK
PVDIPLITES

MDVIKTQQISARTIEKVVVHPLVLLSIVDHYNRVAKDSSKRVVGVLLGSSSRGVVDVTNS
YAVPFEEDDKDPSIWFLDHNYHESMFHMFKRINAKEHVVGWYSTGPKLRENDLDVHALFN
GYVPNPVLVIIDVQPKELGIPTKAYYAVEEVKENATQKSQKVFVHVSTEIAAHEVEEIGV
EHLLRDVKDTTISTLATEVTAKLTALKGLDARLREIRSYLDLVIEGKLPLNHEILYHLQD
VFNLLPNLNVNELVKAFSVKTNDMMLVIYLSSLIRSVIALHNLINNKLLNKEHEKAEDSK
PVAIPATS

Other information
Ka divergence:-0.352094KaKs divergence:-0.113088
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):933Length 2 (bp):927Length divergence:-0.003
MFE 1 (kcal):-251.62MFE 2 (kcal):-275MFE divergence0.044