Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11280-AT5G05790
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Duplicated homeodomain-like superfamily protein
Function (paralog2):Duplicated homeodomain-like superfamily protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-2.6871797621246
Log2 mRNA fold difference:-2.9639162476755
Log2 TE fold difference:0.32261725254264
Sequences
Protein sequence

METLHPFSHLPISDHRFVVQEMVSLHSSSSGSWTKEENKMFERALAIYAEDSPDRWFKVA
SMIPGKTVFDVMKQYSKLEEDVFDIEAGRVPIPGYPAASSPLGFDTDMCRKRPSGARGSD
QDRKKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVVSKTPTQVASHAQKYYQRQLSGA
KDKRRPSIHDITTGNLLNANLNRSFSDHRDILPDLGFIDKDDTEEGVIFMGQNLSSENLF
SPSPTSFEAAINFAGENVFSAGA

METLHPLLSHVPTSDHRFVVQEMMCLQSSSWTKEENKKFERALAVYADDTPDRWFKVAAM
IPGKTISDVMRQYSKLEEDLFDIEAGLVPIPGYRSVTPCGFDQVVSPRDFDAYRKLPNGA
RGFDQDRRKGVPWTEEEHRRFLLGLLKYGKGDWRNISRNFVGSKTPTQVASHAQKYYQRQ
LSGAKDKRRPSIHDITTVNLLNANLSRPSSDHGCLVSKQAEPKLGFTDRDNAEEGVMFLG
QNLSSVFSSYDPAIKFSGANVYGEGGYCISQDLETRK

Other information
Ka divergence:0.141644KaKs divergence:-0.089599
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):792Length 2 (bp):834Length divergence:0.026
MFE 1 (kcal):-242.1MFE 2 (kcal):-242.5MFE divergence0.001