Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11320-AT5G05820
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Nucleotide-sugar transporter family protein
Function (paralog2):Nucleotide-sugar transporter family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.27788107797153
Log2 mRNA fold difference:-0.32912240600092
Log2 TE fold difference:0.043114110155767
Sequences
Protein sequence

MKIAANGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAI
AWMKMVPMQTIRSRVQFLKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVF
AYLITFKREAWLTYFTLVPVVTGVVIASGSEPSFHLFGFIMCIAATAARALKSVLQGILL
SSEGEKLNSMNLLLYMAPIAVVFLLPATLIMEKNVVGITIALARDDFRIVWYLLFNSALA
YFVNLTNFLVTKHTSALTLQVLGNAKGAVAVVVSILIFRNPVSVTGMLGYSLTVCGVILY
SEAKKRSK

MKMATNGRFFTIGLVASWYSSNIGVLLLNKYLLSNYGFKYPIFLTMCHMTACSLLSYVAI
AWLKMVPMQTIRSRVQFFKIAALSLVFCVSVVFGNISLRFLPVSFNQAIGATTPFFTAVF
AYLMTRKKEAWLTYFTLVPVVTGVVIASGGEPSFHLFGFLMCIAATAARALKSVLQGILL
SSEGEKLNSMNLLLYMAPIAVVLLLPATLIMEKNVVGITIALARDDFRIVWYLLFNSALA
YLVNLTNFLVTNHTSALTLQVLGNAKGAVAVVVSILIFKNPVSVTGMLGYSLTVCGVILY
SEAKKRNKN

www.000webhost.com

Other information
Ka divergence:0.290913KaKs divergence:0.311441
GC content 1 (%):44GC content 2 (%):46GC content divergence:0.022
Length 1 (bp):927Length 2 (bp):930Length divergence:0.002
MFE 1 (kcal):-282.8MFE 2 (kcal):-276.72MFE divergence-0.011