Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11330-AT5G05850
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):plant intracellular ras group-related LRR 9
Function (paralog2):plant intracellular ras group-related LRR 1

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-3.3451333232
Log2 mRNA fold difference:-2.3561511219966
Log2 TE fold difference:-0.98622499746521
Sequences
Protein sequence

MAAEPNPKNFPVLSYVLARLPSFTAKSPSSSVPPFDIEQPPPSSSSSSIEIVTQMPHLTQ
PDVLASMTSAISDVAETRSILRTLGPRPDHESVDKARAKLSEIESFLSESFEDIALTDAA
AKDEKRRQEMDQEKTWCESILKLDEVHASYEKLLKEAEERLVRIYESAEKNAAEDEENVA
AVEVNEEVVGILQHASANPVDRVDLSGRKLRLLPEAFGRIQGLLVLNLSNNKLESIPDSI
AGLHSLVELDVSTNSLETLPDSIGLLSKLKILNVSTNKLTSLPDSICRCGSLVILDVSFN
RLTYLPTNIGPELVNLEKLLVQYNKIRSFPTSIGEMRSLKHLDAHFNELNGLPDSFVLLT
NLEYLNLSSNFSDLKDLPFSFGELISLQELDLSNNQIHALPDTFGTLDSLTKLNVDQNPL
VVPPEEVVKEGVEAVKTYMGQRRISMLEEEEKKKMEEEMEQANAGWLTRTTSKLKTYVAD
VSEYLGSNSPRDPYLERQL

MATELNPKNFPVLSYVLDRLPSFTAKSSSSSDVEPPPSKSDPSSSSNHSIEIVTQMPHLA
HPDVLASMTNATADVSQTRSVLRTLGPRPDHETVDRARARLREIDASLSESFEEIALSPN
DIDVAEKEQKRREAVEQEKIWYKSILKLNELHESYEKLLKEAEERLVRIYESAEKNAAAV
AEEEAAEVEVNEEVVSILQQAAENPLDRVDLSGRKLKLLPEAFGKIQGLLVLNLYNNQLQ
AIPDSIAGLHNLLELDVSTNFLETLPDSIGLLSKLKILNVSCNKLTTLPDSICHCGSLVV
LDASYNNLTYLPTNIGFELVKLEKLLIHLNKIRSLPTSIGEMRSLRYLDAHFNELNGLPN
SFGLLTNLEYLNLSSNFSDLQDLPASFGDLISLQELDLSNNQIHSLPDAFGTLVNLTKLN
LDQNPLVVPPDEVVKQGVDAVKMYMGKRWVSMLEEEEKMANMKDEMDQTNTDWLTRTTSK
LKTYVTEVSEYLGSNPPRDPYLDQQL

www.000webhost.com

Other information
Ka divergence:-0.152839KaKs divergence:-0.317721
GC content 1 (%):47GC content 2 (%):46GC content divergence:-0.011
Length 1 (bp):1500Length 2 (bp):1521Length divergence:0.007
MFE 1 (kcal):-458.66MFE 2 (kcal):-475.54MFE divergence0.018