Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11397-AT5G05987
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):prenylated RAB acceptor 1.A3
Function (paralog2):prenylated RAB acceptor 1.A2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.83540019767121
Log2 mRNA fold difference:-0.44442092495974
Log2 TE fold difference:-0.44123072714502
Sequences
Protein sequence

MDWDSVAAEDVIEALREVEWSASPRSLAEFFSRFAFPRSFSKWMSRLKCNLYYYRTNYFI
LFVFVLGLALITRPLAILGAALTALSLAFLNDSFAATFNEKMIRTIRHFSPHLAAKMRPP
HMPVIRGRSATRKTVYICGQPRLVFVLLGLTASFVLWFTSCGLLWVLYALTTALLMILLH
ASLRTPNLKARLNTFREEFRAVWRNYSEL

MDWDNVAAEDVIEALREVEWSTPPRSFGEFFSRFAFPRSFSKWKSRLKCNLYYYRTNYFI
LVIFVLGLALVTRPLALVGAALTALSIAFLNDSFAASFNEKFIRTIRHFSPHMAAKMRPP
HMPVIRGRSTARKTVYVCGKPRWVFVITFLTASLVMWFSSCGLLWVLYALLTSLAVIIVH
ASIRTPNLKARLNTFREEFRAVWRNYSEL

www.000webhost.com

Other information
Ka divergence:0.155624KaKs divergence:0.347846
GC content 1 (%):46GC content 2 (%):45GC content divergence:-0.011
Length 1 (bp):630Length 2 (bp):630Length divergence:0
MFE 1 (kcal):-182.39MFE 2 (kcal):-187.69MFE divergence0.014