Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11400-AT5G06000
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):eukaryotic translation initiation factor 3G1
Function (paralog2):eukaryotic translation initiation factor 3G2

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-4.4599264093443
Log2 mRNA fold difference:-0.282544875719
Log2 TE fold difference:-4.1571744981436
Sequences
Protein sequence

MTIDSQQKTSKFRWGEMDEDEDLDFLLPPKQVIGPDENGLKTTIEYKFNDEENKVKITTR
TRVRKLASARLNKRAMERRNWPKFGDAANEEAGSHLTMVSTEEILLERPRAPGDQLANHM
LASIPEYELKCALTFVAANCTKADESKATGDGLSQLGKGGAVLMVCRICHKKGDHWTSKC
PYKDLAAPTDVFIDKPPTGESSTMSAAPGTGKAAYVPPSMRAGADRSAVGSDMRRRNDEN
SVRVTNLSEDTREPDLMELFHPFGAVTRVYVAIDQKTGVSRGFGFVNFVSREDAQRAINK
LNGYGYDNLILRVEWATPRPT

MAIDTIQKTKKLRWGEIDEEEGDYDFLLPPKQMISPDQNGVKKVIEYKFNEEDKKVKITT
TTRVQKRALTKQAVERRSWNKFGDAAHEESSSYLTMRSTEDIILERIRAPGSNAEQSTVS
GDSMSQLGKPGAVLMVCRLCQKKGDHWTSRCPQKDLLSLMDEPLTAETSTSTITGTGRAA
YVPPSMREGADRKAGGSDMRSRHDENSVRVTNLSEDTRGPDLMELFRPFGAVTRCHVAID
QKTSMSRGFGFVSFVSREDAQRAINKLNGYGYDNLILRVEWSTPKTQLDPFSFADYNNLC
KLLNICHS

Other information
Ka divergence:0.463574KaKs divergence:0.428487
GC content 1 (%):49GC content 2 (%):45GC content divergence:-0.043
Length 1 (bp):966Length 2 (bp):927Length divergence:-0.021
MFE 1 (kcal):-313.42MFE 2 (kcal):-275.2MFE divergence-0.065