Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11430-AT5G06090
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):glycerol-3-phosphate acyltransferase 5
Function (paralog2):glycerol-3-phosphate acyltransferase 7

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.6352639640699
Log2 mRNA fold difference:-0.65960182285238
Log2 TE fold difference:0.11388456564996
Sequences
Protein sequence

MVMEQAGTTSYSVVSEFEGTILKNADSFSYFMLVAFEAAGLIRFAILLFLWPVITLLDVF
SYKNAALKLKIFVATVGLREPEIESVARAVLPKFYMDDVSMDTWRVFSSCKKRVVVTRMP
RVMVERFAKEHLRADEVIGTELIVNRFGFVTGLIRETDVDQSALNRVANLFVGRRPQLGL
GKPALTASTNFLSLCEEHIHAPIPENYNHGDQQLQLRPLPVIFHDGRLVKRPTPATALII
LLWIPFGIILAVIRIFLGAVLPLWATPYVSQIFGGHIIVKGKPPQPPAAGKSGVLFVCTH
RTLMDPVVLSYVLGRSIPAVTYSISRLSEILSPIPTVRLTRIRDVDAAKIKQQLSKGDLV
VCPEGTTCREPFLLRFSALFAELTDRIVPVAMNYRVGFFHATTARGWKGLDPIFFFMNPR
PVYEITFLNQLPMEATCSSGKSPHDVANYVQRILAATLGFECTNFTRKDKYRVLAGNDGT
VSYLSLLDQLKKVVSTFEPCLH

MESSTTTSYSVVSELEGTLLKNPKPFAYFMLVAFEASGLIRFATLLFLWPIIALLDVLGY
RNGSLKLMIFVATAGLHESEIESVARAVLPKFFMDDISMDAWRAFGSCDKRVVVTRMPRV
MVERFAKDHLSADEVIGTEIVVNRFGYATGLIQETNVDQSVFNSVANLFVDRRPQLGLGR
HIISDSPTFLSLCEEQVHAPVPSNYNGHNQRLHVQPLPVIFHDGRLVKLPTPATALIILL
WIPFGIILAMIRIFVGFLLPLWAIPYVSRIFNTRFIVKGKPPAQATTGNPGVLFVCTHRT
LMDPVVLSYVLGRSIPAVTYSISRLSEILSPIPTFRLTRIRDVDAEMIKKELSNGDLVVY
PEGTTCREPFLLRFSALFAELTDNIVPVAMNYRVGFFHATTARGWKGLDPIFFFMNPRPV
YEVTFLNQLEVEATCSSGKSPYDVANYVQRILAATLGFECTNFTRKDKYRVLAGNDGTVS
YLSFLDQVKKVVTTFKPFLH

www.000webhost.com

Other information
Ka divergence:0.0018537KaKs divergence:-0.332825
GC content 1 (%):48GC content 2 (%):46GC content divergence:-0.021
Length 1 (bp):1509Length 2 (bp):1503Length divergence:-0.002
MFE 1 (kcal):-503.29MFE 2 (kcal):-469.83MFE divergence-0.034