Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11440-AT5G06100
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):myb domain protein 65
Function (paralog2):myb domain protein 33

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.37840659000459
Log2 mRNA fold difference:0.25886575661203
Log2 TE fold difference:-0.03103645264149
Sequences
Protein sequence

MSYTTATADSDDGMHSSIHNESPAPDSISNGCRSRGKRSVLKKGPWTSTEDGILIDYVKK
HGEGNWNAVQKHTSLARCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVEMHAKMGNKWAQ
MAEHLPGRTDNEIKNYWNTRIKRRQRAGLPLYPPEIYVDDLHWSEEYTKSNIIRVDRRRR
HQDFLQLGNSKDNVLFDDLNFAASLLPAASDLSDLVACNMLGTGASSSRYESYMPPILPS
PKQIWESGSRFPMCSSNIKHEFQSPEHFQNTAVQKNPRSCSISPCDVDHHPYENQHSSHM
MMVPDSHTVTYGMHPTSKPLFGAVKLELPSFQYSETSAFDQWKTTPSPPHSDLLDSVDAY
IQSPPPSQVEESDCFSSCDTGLLDMLLHEAKIKTSAKHSLLMSSPQKSFSSTTCTTNVTQ
NVPRGSENLIKSGEYEDSQKYLGRSEITSPSQLSAGGFSSAFAGNVVKTEELDQVWEPKR
VDITRPDVLLASSWLDQGCYGIVSDTSSMSDALALLGGDDIGNSYVTVGSSSGQAPRGVG
SYGWTNMPPVWSL

MSYTSTDSDHNESPAADDNGSDCRSRWDGHALKKGPWSSAEDDILIDYVNKHGEGNWNAV
QKHTSLFRCGKSCRLRWANHLRPNLKKGAFSQEEEQLIVELHAKMGNRWARMAAHLPGRT
DNEIKNYWNTRIKRRQRAGLPLYPPEMHVEALEWSQEYAKSRVMGEDRRHQDFLQLGSCE
SNVFFDTLNFTDMVPGTFDLADMTAYKNMGNCASSPRYENFMTPTIPSSKRLWESELLYP
GCSSTIKQEFSSPEQFRNTSPQTISKTCSFSVPCDVEHPLYGNRHSPVMIPDSHTPTDGI
VPYSKPLYGAVKLELPSFQYSETTFDQWKKSSSPPHSDLLDPFDTYIQSPPPPTGGEESD
LYSNFDTGLLDMLLLEAKIRNNSTKNNLYRSCASTIPSADLGQVTVSQTKSEEFDNSLKS
FLVHSEMSTQNADETPPRQREKKRKPLLDITRPDVLLASSWLDHGLGIVKETGSMSDALA
VLLGDDIGNDYMNMSVGASSGVGSCSWSNMPPVCQMTELP

Other information
Ka divergence:-0.110215KaKs divergence:-0.358836
GC content 1 (%):44GC content 2 (%):44GC content divergence:0
Length 1 (bp):1662Length 2 (bp):1563Length divergence:-0.031
MFE 1 (kcal):-520.21MFE 2 (kcal):-469.52MFE divergence-0.051