Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11450-AT5G06110
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):DnaJ domain ;Myb-like DNA-binding domain
Function (paralog2):DnaJ domain ;Myb-like DNA-binding domain

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.61797482773634
Log2 mRNA fold difference:0.094172449181065
Log2 TE fold difference:0.41671320854668
Sequences
Protein sequence

MPSRRSESAIRLITYSEELVDGKPFFAFSNCLPVKALNREPAGHAFHSAALKLHGCAEEP
TDDEGGDKKVGDDKEKEYVPSFNSYANKGKKKSGTQQQDHYALLGLSNLRYLATEDQIRK
SYREAALKHHPDKLASLLLLEETEEAKEAKKDEIESRFKAIQEAYEVLMDPTRRRIFDST
DEFDDEVPSDCLPQDFFKVFGPAFKRNARWSVNQRIPDLGDENTPLKDVDKFYNFWYAFK
SWREFPDEEEHDLEQADSREERRWMEKENAKKTVKARKEEHARIRTLVDNAYRKDPRIVK
RKEEEKAEKQQKKDAKIQAKKKQEEDAAIAAEEEKRRKEEEEKRAAESAQQQKKTKEREK
KLLRKERNRLRTLSAPLVAQRLLDISEEDIENLCMSLNTEQLQNLCDKMGNKEGLELAKV
IKDGCNSSRNDEAESKEKVSKKTNGGTEPTTRVSQLDSSTQKKQPWSKEEIDMLRKGMIK
YPKGTSRRWEVISEYIGTGRSVEEILKATKTVLLQKPDSAKAFDSFLEKRKPSASITSPL
STREELGESLPTMTTTTNAKPSKETVVGKSSSSQSSDNNGEVGGSSDADSWSTVQERALV
QALKTFPKETSQRWERVAAAVPGKTMNQCKKKFAELKEIIRNKKTGV

MQSWGINSAIKLLTYSSELKDGQALYASSNCHPVKALNREPAGHAFHSAALKLRGCAKEA
TSKNEDTDKKVPKEKDGEYIPSYDSHNIKGKKKSGKLQHDHYALLGLGNLRYLATDDQIR
KSYRDAALKHHPDKLATLLLLEETEEAKQAKKDEIESHFKLIQEAYEVLMDSTKRRIFDS
TDEFDDKVPTDCAPQDFFKVFGPAFKRNARWSNSPLPDLGDENTPLKEVDRFYSTWYTFK
SWREFPEEEEHDIEQAESREEKRWMERENARKTQKARKEEYARIRTLVDNAYKKDIRIQK
RKDDEKAKKLQKKEAKVMAKRQQEEAAAAAIEEEKRRKEEEAKRAAEAAQLHKRAKEREK
KLLRKERSRLRVLSAPVLSQRLLGISDEHVEDLCMSLNTEQLRKLCDKMENKEGMALAKV
IKNGSNIDDDKIEIEEEEVQVAVKQNGHIEANGHVEANGHVEAKVDTATHEKKEKPWSKE
EIDMLRKGTTKFPKGTSQRWEVISEYIGTGRSVEEILKATKTVLLQKPDSAKAFDSFLEN
RKPAASINSPLSTREELGEPIIPTKAHEDNNSTKTETAEQNGKTKENNNSNGNSEPAAAS
GSDPDGWSAVQERALVQALKTFPKETNQRWERVATAVPGKTMNQCKKKFADLKDVIRTKK
PTA

Other information
Ka divergence:0.249279KaKs divergence:0.643
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1944Length 2 (bp):1992Length divergence:0.012
MFE 1 (kcal):-543.66MFE 2 (kcal):-574.53MFE divergence0.028