Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11520-AT5G06150
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):CYCLIN B1;3
Function (paralog2):Cyclin family protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:1.1244446408579
Log2 mRNA fold difference:0.047012935043033
Log2 TE fold difference:1.0715392051256
Sequences
Protein sequence

MATGPVVHPQPVRGDPIDLKNAAAKNRRALGDIGNVDSLIGVEGGKLNRPITRNFRAQLL
ENAQVAAAANKKAPILDGVTKKQEVVRAVQKKARGDKREPSKPIEVIVISPDTNEVAKAK
ENKKKVTYSSVLDARSKAASKTLDIDYVDKENDLAAVEYVEDMYIFYKEVVNESKPQMYM
HTQPEIDEKMRSILIDWLVEVHVKFDLSPETLYLTVNIIDRFLSLKTVPRRELQLVGVSA
LLIASKYEEIWPPQVNDLVYVTDNSYNSRQILVMEKTILGNLEWYLTVPTQYVFLVRFIK
ASGSDQKLENLVHFLAELGLMHHDSLMFCPSMLAASAVYTARCCLNKTPTWTDTLKFHTG
YSESQLMDCSKLLAFIHSKAGESKLRGVLKKYSKLGRGAVALISPAKSLMSSAP

MATRANVPEQVRGAPLVDGLKIQNKNGAVKSRRALGDIGNLVSVPGVQGGKAQPPINRPI
TRSFRAQLLANAQLERKPINGDNKVPALGPKRQPLAARNPEAQRAVQKKNLVVKQQTKPV
EVIETKKEVTKKEVAMSPKNKKVTYSSVLSARSKAACGIVNKPKIIDIDESDKDNHLAAV
EYVDDMYSFYKEVEKESQPKMYMHIQTEMNEKMRAILIDWLLEVHIKFELNLETLYLTVN
IIDRFLSVKAVPKRELQLVGISALLIASKYEEIWPPQVNDLVYVTDNAYSSRQILVMEKA
ILGNLEWYLTVPTQYVFLVRFIKASMSDPEMENMVHFLAELGMMHYDTLTFCPSMLAASA
VYTARCSLNKSPAWTDTLQFHTGYTESEIMDCSKLLAFLHSRCGESRLRAVYKKYSKAEN
GGVAMVSPAKSLLSAAADWKKPVSS

www.000webhost.com

Other information
Ka divergence:-0.0717154KaKs divergence:0.447138
GC content 1 (%):43GC content 2 (%):45GC content divergence:0.023
Length 1 (bp):1245Length 2 (bp):1338Length divergence:0.036
MFE 1 (kcal):-360.2MFE 2 (kcal):-390.49MFE divergence0.04