Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11550-AT5G06200
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Uncharacterised protein family (UPF0497)
Function (paralog2):Uncharacterised protein family (UPF0497)

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.98184588929229
Log2 mRNA fold difference:-1.0239043858971
Log2 TE fold difference:0.041552489444506
Sequences
Protein sequence

MKNESTFIDVPAESSSAMKGKAPLIGVARDHTTSGSGGYNRGLAIFDFLLRLAAIVAALA
AAATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVIAMALVGGYLVLSLPISVVTILRPL
ATAPRLLLLVLDTGVLALNTAAASSAAAISYLAHSGNQNTNWLPICQQFGDFCQKSSGAV
VSAFVSVVFFTILVVISGVALKRH

MKSDSIAVDVPAESSSVIKGKAPLLGLARDHTGSGGYKRGLSIFDFLLRLAAIVAALAAA
ATMGTSDETLPFFTQFLQFEASYDDLPTFQFFVVAIAIVAGYLVLSLPFSVVTIVRPLAV
APRLLLLVLDTAALALDTAAASAAAAIVYLAHNGNTNTNWLPICQQFGDFCQKTSGAVVS
AFASVTFLAILVVISGVSLKRP

www.000webhost.com

Other information
Ka divergence:-0.0170906KaKs divergence:-0.0320755
GC content 1 (%):51GC content 2 (%):49GC content divergence:-0.02
Length 1 (bp):615Length 2 (bp):609Length divergence:-0.005
MFE 1 (kcal):-176.35MFE 2 (kcal):-185.71MFE divergence0.026