Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11560-AT5G06220
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):LETM1-like protein
Function (paralog2):LETM1-like protein

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:0.39306651265647
Log2 mRNA fold difference:-0.12132217450538
Log2 TE fold difference:0.43673082198331
Sequences
Protein sequence

MAARLQRPGLVSSSSTSKPCLPRMSIVTFISCKRTVHLEYLSNCLSNPRSQLFVRYGFLE
RSNKKKSQRLVLASAEDGVAINGSPQPRSSSNLEDMRTSFTGSLQDENNSNGLNQSLHDA
ARSIELAVKEKITPSRFSWFPSTWLGADKYAWVKTLSYQASLYSLLQAVNEISSRGNYRD
EDINVFVQRSLSRQAAPLENMMRENLSSKHPKAYEWFWSEQVPSVVTSFVNYLEGDQRFV
AATSVYAKGKSAAASNEIEVSLLMLVLNCIAAITKVGPAKFSCPPFFSMIPDTTGRLMEK
LVDFVPLPQAYHSIKSIGLQREFLTHFGPRAAVCRVNGDIDTDEVIFWVDLIQKQLQRAI
DREKIWSKLTTSESIEVLERDLAIFGFFIALGRSTQSILAANGFDSLENPLEDLVRHLIG
GSVLYYPQLSAISSYQLYVEVVCEELEWIPFYPNNTGTQPPNQSHGHKTKPEGPPNYEVI
PQLLDVCSYWLQSFIKYSKWPENPSNVKAAKFLSKGHKTLVRCKEELGILKNASSIVRES
NSFDKALESVDEALVRLESLLQELYVSNSSSGKEQIKAACSDLEKIRKLKKEAEFLEATF
RAKAASLQQGGDKNDSQESYEVQKRYFKGKDTKNANSSEDQGKSISRGFWGFFVRPSRKK
LDPELSGDEYIGKSSGNLLSIDSEPIEISRFEILRNELIELEKRVKRSTDQSVDEEELIS
EDTPQSSSRTESVQLVQTPKKENMMEKTLQKLREATTDVWQGTQLLAIDSAAAVQLLRRS
LIGDELTGKEKKALRRTMTDLASVIPIGILMLLPVTAVGHAAMLAGIQRYVPGLIPSTYG
SERLNLLRQLEKIKELQTNETESEEGVEEIAL

MAVKFHRPGLVPSSCSNPWMSVGTLISCRRVLQLDYISNCCGNSRTQLFVTYDDKNYFLQ
RKLFGNKKMSSRRTTQPFLLASAEDGVAVNGSRASDDVQEMRAKLSGSLQDEYSCGELIQ
SLHDAARTFELALKEKISSSRLPWFSAAWLGVDRNAWVKTFSYQASVYCLLQAANEVSSR
GNNRDDDLNVFVQRSLSRQAAPLDSMMRDKLSSSHPEANEWFWSGQVPSAVTSFVNCFEG
DQRFVSATSVYVKSNSTAASNEIEVSLLMLVLNCIAAVTKLGPTKLSCPPFFSVIPDTTG
RLMDKFVGFVPLPQTYHSMKTLGLRREFLLHFGPRAAACRVKSDCDTDEVVFWVDLIQNQ
LLRAIDREKIWSRLITSESIEVLDRDLAIFGFFIALGKSTQSFLAANGFSSLENPVEDLV
RHFIGGSLLQYPQLSAISSYQLYVEVVCEELDWIPFYPARKDSQPAEQSHGHKSRPQGPP
NYDALPQILNVCSYWLQSFIKYSKWPENPSNVKAAKFLSKGARKNWEYQGKLMKSDVFCR
KKLRVSIFRTPYISIPMHFAFFLAVTEASFIDMTSSSTDGESSSFDKALESVDGALVRLE
SLLQQLHASSSSSGKEQIKAACSDLEKIRKLKKEAEFLEASFRAKAASLQEGGGDSDSQE
YSEEQSQYLRGKDPKNSINSVDQGTRDSGFWGFFVRTPKGKPGPESLTDKYFEKSRENVD
NVDSNPNEIYRFELLRNELIELEKRVQGSTDESGRTSEDLPKSSSSTKGVQLVQSSKKEN
VIEKTLDQLKDATTDVWQGTQLLAFDSAAAMELLRRSVVGDELTEKEKKALRRTMTDLAS
VVPIGVLMLLPVTAVGHAAMLAAIQRYVPGLIPSTYGAERLNLLRQLEKVKQMQTNETEP
EEGIDEPES

Other information
Ka divergence:0.199944KaKs divergence:0.0950053
GC content 1 (%):42GC content 2 (%):43GC content divergence:0.012
Length 1 (bp):2619Length 2 (bp):2730Length divergence:0.021
MFE 1 (kcal):-780.16MFE 2 (kcal):-875.32MFE divergence0.057