Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11580-AT5G06250
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):AP2/B3-like transcriptional factor family protein
Function (paralog2):AP2/B3-like transcriptional factor family protein

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:-0.87999146904019
Log2 mRNA fold difference:0.092117642758192
Log2 TE fold difference:-0.69176738437854
Sequences
Protein sequence

MSVNHYHNTLSLHHHHQNDVAIAQRESLFEKSLTPSDVGKLNRLVIPKQHAEKYFPLNNN
NNNGGSGDDVATTEKGMLLSFEDESGKCWKFRYSYWNSSQSYVLTKGWSRYVKDKHLDAG
DVVFFQRHRFDLHRLFIGWRRRGEASSSPAVSVVSQEALVNTTAYWSGLTTPYRQVHAST
TYPNIHQEYSHYGAVVDHAQSIPPVVAGSSRTVRLFGVNLECHGDAVEPPPRPDVYNDQH
IYYYSTPHPMNISFAGEALEQVGDGRG

MSVNHYSTDHHHTLLWQQQQHRHTTDTSETTTTATWLHDDLKESLFEKSLTPSDVGKLNR
LVIPKQHAEKYFPLNAVLVSSAAADTSSSEKGMLLSFEDESGKSWRFRYSYWNSSQSYVL
TKGWSRFVKDKQLDPGDVVFFQRHRSDSRRLFIGWRRRGQGSSSSVAATNSAVNTSSMGA
LSYHQIHATSNYSNPPSHSEYSHYGAAVATAAETHSTPSSSVVGSSRTVRLFGVNLECQM
DENDGDDSVAVATTVESPDGYYGQNMYYYYSHPHNMVILTLL

www.000webhost.com

Other information
Ka divergence:-0.367692KaKs divergence:-0.171779
GC content 1 (%):48GC content 2 (%):49GC content divergence:0.01
Length 1 (bp):804Length 2 (bp):849Length divergence:0.027
MFE 1 (kcal):-261.9MFE 2 (kcal):-257.3MFE divergence-0.009