Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11600-AT5G06270
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:root_Hsu_2016
Log2 RF fold difference:-0.67564875477371
Log2 mRNA fold difference:-1.0966626448787
Log2 TE fold difference:0.38929903481848
Sequences
Protein sequence

MSRRNKNGPKLELRLNLSPPPSQASQMSLVRSPNRSNTTSPSSCVSSETNQEENETITSM
VLVGCPRCLMYVMLSDDDPKCPKCKSTVLLDFLQENAFAATTATAANTRRKKKTWWN

MSRRSPKLELKLNLSPPTSSQRRMVRSPSRSATTSPTSPPSSCVSSEMNQDEPSVRYSTS
PETTSMVLVGCPRCLMYVMLSEDDPKCPKCKSTVLLDFLHENATNANANAAAASSGRKTR
RN

www.000webhost.com

Other information
Ka divergence:-0.720423KaKs divergence:0.995579
GC content 1 (%):48GC content 2 (%):52GC content divergence:0.04
Length 1 (bp):354Length 2 (bp):369Length divergence:0.021
MFE 1 (kcal):-99.6MFE 2 (kcal):-106.2MFE divergence0.032