Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11630-AT5G06290
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Thioredoxin superfamily protein
Function (paralog2):2-cysteine peroxiredoxin B

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-1.9982063170797
Log2 mRNA fold difference:-1.3188775994504
Log2 TE fold difference:-0.90906672761854
Sequences
Protein sequence

MASVASSTTLISSPSSRVFPAKSSLSSPSVSFLRTLSSPSASASLRSGFARRSSLSSTSR
RSFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSDYIGKKYVILFFYPLDFTFVCP
TEITAFSDRHSEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLISDVTKSIS
KSFGVLIHDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYIQENPDEV
CPAGWKPGEKSMKPDPKLSKEYFSAI

MSMASIASSSSTTLLSSSRVLLPSKSSLLSPTVSFPRIIPSSSASSSSLCSGFSSLGSLT
TNRSASRRNFAVKAQADDLPLVGNKAPDFEAEAVFDQEFIKVKLSEYIGKKYVILFFYPL
DFTFVCPTEITAFSDRYEEFEKLNTEVLGVSVDSVFSHLAWVQTDRKSGGLGDLNYPLVS
DITKSISKSFGVLIPDQGIALRGLFIIDKEGVIQHSTINNLGIGRSVDETMRTLQALQYV
QENPDEVCPAGWKPGEKSMKPDPKLSKEYFSAI

Other information
Ka divergence:0.400744KaKs divergence:0.074
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):801Length 2 (bp):822Length divergence:0.013
MFE 1 (kcal):-231.4MFE 2 (kcal):-236.13MFE divergence0.01