Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11650-AT5G06320
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NDR1/HIN1-like 2
Function (paralog2):NDR1/HIN1-like 3

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:3.4342947125292
Log2 mRNA fold difference:2.8235282198124
Log2 TE fold difference:0.56647139116093
Sequences
Protein sequence

MGSKQPYLNGAYYGPSIPPPPKAHRSYNSPGFGCCCFSCLGSCLRCCGCCILSLICNILI
AVAVILGVAALILWLIFRPNAVKFYVADANLNRFSFDPNNNLHYSLDLNFTIRNPNQRVG
VYYDEFSVSGYYGDQRFGSANVSSFYQGHKNTTVILTKIEGQNLVVLGDGARTDLKDDEK
SGIYRINAKLRLSVRFKFWFIKSWKLKPKIKCDDLKIPLGSSNSTGGFKFQPVQCDFDLS

MADLNGAYYGPSIPPPKKVSHSHGRRGGGCGCLGDCLGCCGCCILSVIFNILITIAVLLG
IAALIIWLIFRPNAIKFHVTDAKLTEFTLDPTNNLRYNLDLNFTIRNPNRRIGVYYDEIE
VRGYYGDQRFGMSNNISKFYQGHKNTTVVGTKLVGQQLVLLDGGERKDLNEDVNSQIYRI
DAKLRLKIRFKFGLIKSWRFKPKIKCDLKVPLTSNSTSGFVFQPTKCDVDF

Other information
Ka divergence:-0.36199KaKs divergence:-0.622308
GC content 1 (%):46GC content 2 (%):47GC content divergence:0.011
Length 1 (bp):723Length 2 (bp):696Length divergence:-0.019
MFE 1 (kcal):-207.26MFE 2 (kcal):-216.7MFE divergence0.022