Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11660-AT5G06330
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):NDR1/HIN1-like 1
Function (paralog2):Late embryogenesis abundant (LEA) hydroxyproline-rich glycoprotein family

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-3.6741434827858
Log2 mRNA fold difference:-2.6206240657329
Log2 TE fold difference:-1.1929471352688
Sequences
Protein sequence

MKDCENHGHSRRKLIRRIFWSIIFVLFIIFLTILLIWAILQPSKPRFILQDATVYAFNVS
GNPPNLLTSNFQITLSSRNPNNKIGIYYDRLDVYATYRSQQITFPTSIPPTYQGHKDVDI
WSPFVYGTSVPIAPFNGVSLDTDKDNGVVLLIIRADGRVRWKVGTFITGKYHLHVKCPAY
INFGNKANGVIVGDNAVKYTFTTSCSVSV

MTSKDCGSHDSHSSCNRKIVIWTISIILLLILVVILLVWAILQPSKPRFVLQDATVFNFN
VSGNPPNLLTSNFQFTLSSRNPNDKIGIYYDRLDVYASYRSQQITLPSPMLTTYQGHKEV
NVWSPFVGGYSVPVAPYNAFYLDQDHSSGAIMLMLHLDGRVRWKVGSFITGKYHLHVRCH
ALINFGSSAAGVIVGKYMLTETCSVSV

Other information
Ka divergence:0.322711KaKs divergence:0.0938967
GC content 1 (%):46GC content 2 (%):48GC content divergence:0.021
Length 1 (bp):630Length 2 (bp):624Length divergence:-0.005
MFE 1 (kcal):-161.35MFE 2 (kcal):-157.41MFE divergence-0.012