Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11700-AT5G06390
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):FASCICLIN-like arabinogalactan protein 18 precursor
Function (paralog2):FASCICLIN-like arabinogalactan protein 17 precursor

Regulation information
Data set:leaf_Lukoszek_2016
Log2 RF fold difference:-0.47783645183167
Log2 mRNA fold difference:-0.85189972050425
Log2 TE fold difference:0.37552743280193
Sequences
Protein sequence

MDRCIYGCSVITIFFSFFFLLNASALESGHHNITGSGQINSNSVLVALLDSRYTELAELV
EKALLLQTLEDAVGRHNITIFAPRNEALERDLDPDFKRFLLQPGNLKSLQTLLLSHIIPK
RVGSNQWPEENSGRVKHVTLGHDQVLHLSKLKGTNGKRLVNSAVITRPDDLTRPDGLIHG
IERLLIPRSVQEDFNRRRNLRSISAVLPEGAPEIDPRTNRLKKSATAVSVPAGSPPVLPI
ESAMAPGPSLAPAPAPGPGGAHKHFNGDAQVKDFIHTLLHYGGYNEMADILVNLTSLATE
MGRLVSEGYVLTVLAPNDEAMGKLTTDQLSEPGAPEQIMYYHIIPEYQTEESMYNSVRRF
GKVKYETLRFPHKVGAKEADGSVKFGSGDRSAYLFDPDIYTDGRISVQGIDGVLFPEEKE
EETVKKPTGPVKKVVQPRRGKLLEVACSMLGAIGKDSYLSRC

MDRRIYGGSAVIHLFLFFSVLIFSAASALSKNQSPSSGSGQINSNSVLVALLDSRYTELA
ELVEKALLLQTLEDAVGRHNITIFAPRNEALERDLDPEFKRFLLEPGNLKSLQTLLMFHI
IPNRVGSNQWPSEESGRVKHHTLGNDQVRLSNGQGKKMVDLAEIIRPDDLTRPDGLIHGI
ERLLIPRSVQEDFNRRRSLQSISAVLPEGAPEVDPRTNRLKKPAAPVPAGSPPALPIQSA
MAPGPSLAPAPAPGPGGKQHHFDGEAQVKDFIHTLLHYGGYNEMADILVNLTSLATEMGR
LVSEGYVLTVLAPNDEAMAKLTTDQLSEPGAPEQIVYYHIIPEYQTEESMYNSVRRFGKV
KFDTLRFPHKVAAKEADGSVKFGDGEKSAYLFDPDIYTDGRISVQGIDGVLFPQEEEVVE
SVKKPVKKIVQPRRGKLLEVACSMLGAFGKDTYLSKCR

Other information
Ka divergence:-0.269215KaKs divergence:-0.0507924
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):1389Length 2 (bp):1377Length divergence:-0.004
MFE 1 (kcal):-445.93MFE 2 (kcal):-453.6MFE divergence0.009