Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:AT3G11720-AT5G06440
Species:Arabidopsis
Duplication type:WGD
Function (paralog1):Polyketide cyclase/dehydrase and lipid transport superfamily protein
Function (paralog2):

Regulation information
Data set:shoot_Hsu_2016
Log2 RF fold difference:1.8789048863976
Log2 mRNA fold difference:1.4466704035485
Log2 TE fold difference:0.46994352026548
Sequences
Protein sequence

MTTTVNRPGPSKIKYVYSRENEGKYLLIGKNISTFLARLVGYASAAGCLLIQLSMEKKRD
VSEYRERLNETLSSPELINEQTLKTLVRKQLNEECSVDILDQRVAALSSTIEKLRSVSTK
DQDLSKSSTEASYGDWKVKHDDKDCRVMYREGLKGSPFHTLLVEGCTDGTIEDCLCVCWE
SSFYEKWWPKLTFPSFRVLEAKCLQKFRIDEQICLLRVKAPWPLTDREAVLQFFVFEYFK
DDLVIILLNSIEVESGSVAEVNAVRIDFVGGVAIQKVTPEKSYIRFIAEVDIKLDLVPPS
LINFMSRQLLGNGFKLFKKTIGSVAESDDYKTVLADPLYTHIREALYSSDKTDEICQVNE
LHSQQGRDCEEKEPKLEADDDMEKENETRDCENESVPCKRDVPEIEEEECVDDLKEENKS
SPSSSSSSSSSSEDEDKNGKTRFCISPEVKQALGTLERVISMVRKSKTDNNNTSTSSEEE
EEEASSSPMQHSGSTQIVSSSKVCIQDPNTELLDEASFAHYHNSNKIAPASPEIDLTTNS
EVTRITVSQATNLFCQTTENSDDNYKPSGLNGGKSSNLQRKRKPSCFGFRFWRRRT

MQKKREICGYRDKLDKTLSSPELTNHETLKSLLRNQLEECDENILDKRTDDVSKLLSKLR
SVSMTDHQVSKLTNDGDWKLKHDLEDCRVMYREGLDGSPFHTLLVEGYMDGPIHECLCVS
WESTLYKKWWPQYAFPPFRILKSTCLQKVGVGEQICLARFVHIENKDEVPWPLTEREMIL
HYFSFEYFKDGLVVILLNTISDLNSIGVSSTDIIIPESPDAVRMDLVGGFVLQKVTPQRS
YFRTIGDMDIKLDLMPPSLMNFISRQLIGNGFRLYKKSVASVAKFDEDYSRALTDPLYTK
IRRALYSTDEAVEEEPKLETNEVNGVTLPKHEHENNGDASVNKPVHCRRTVPEIEEEEES
EESVYSEDGNEIAKTHVDMRRRFCVSPEVEQALGTLDRVIFMVRNITPVPETEELSPNRA
DDQAKQVSVLENIESVPQTQESSSDFSEEEKREEDTGQNQGMLNKGKNSSLQRKRKARCF
AFRSWL

www.000webhost.com

Other information
Ka divergence:-0.291466KaKs divergence:-0.290489
GC content 1 (%):40GC content 2 (%):40GC content divergence:0
Length 1 (bp):1791Length 2 (bp):1461Length divergence:-0.101
MFE 1 (kcal):-506.32MFE 2 (kcal):-400.32MFE divergence-0.117